Chemistry:SNX-482

From HandWiki
Revision as of 02:46, 6 February 2024 by WikiEd2 (talk | contribs) (fixing)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)

SNX-482 is a toxin from the tarantula Hysterocrates gigas. It acts as a high-affinity blocker of R-type Ca2+ (Cav2.3) channels, but at higher concentrations it can also block other Ca2+ channels and Na+ channels.

Sources

SNX-482 is isolated from the venom of the spider Hysterocrates gigas.[1]

Sequence

GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD-OH[1]

Homology

SNX-482 is homologous to the spider peptides grammatoxin S1A and hanatoxin.[1]

Target

Cav2.3 (alpha1E, R-type) channel (strong affinity), L-type Ca2+ channel, P/Q type Ca2+ channel, Na+ channel.[1][2][3] "SNX-482 [also] dramatically reduced the A-type potassium current in acutely dissociated dopamine neurons from mouse substantia nigra pars compacta."[4]

Mode of action

The compound was initially identified as a selective, voltage-dependent inhibitor of Cav2.3 (a1E, R-type) channels.[1] SNX-482 inhibits native R-type Ca2+ currents at weak nanomolar concentrations in rat neurohypophyseal nerve terminals. However, it does not influence R-type Ca2+ currents at concentrations of 200–500 nM in several types of rat central neurons.[1] Washout could only moderately reverse the R-type Ca2+ channel inhibition after treatment with 200 nM SNX-482. However, application of strong voltage reverses the blocking of R-type Ca2+ channels.[2] SNX-482 needs to interact with a1E domains III and IV to play a role in the significant inhibition of R-type channel gating.[2] Although SNX-482 is generally viewed as a selective inhibitor of Cav2.3 (a1E, R-type) channels, more recently it was shown that it can also inhibit L-type or P/Q type Ca2+ channels and incompletely block Na+ channels.[1][2][3]

Research and therapeutic use

SNX-482 has been used to elucidate the roles of theaflavin-3-G in transmitter release.[5] Furthermore, some research has indicated that it inhibits neuronal responses in a neuropathic pain model, so it is possible that SNX-482 can be used to reduce dorsal horn neuronal pain in neuropathic pain therapy.[6]

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Newcomb, Robert et al. (1998-11-01). "Selective Peptide Antagonist of the Class E Calcium Channel from the Venom of the Tarantula Hysterocrates gigas". Biochemistry 37 (44): 15353–15362. doi:10.1021/bi981255g. ISSN 0006-2960. PMID 9799496. 
  2. 2.0 2.1 2.2 2.3 Bourinet, Emmanuel et al. (2001). "Interaction of SNX482 with Domains III and IV Inhibits Activation Gating of α1E (CaV2.3) Calcium Channels". Biophysical Journal (Elsevier BV) 81 (1): 79–88. doi:10.1016/s0006-3495(01)75681-0. ISSN 0006-3495. PMID 11423396. Bibcode2001BpJ....81...79B. 
  3. 3.0 3.1 Arroyo, G (2003-08-15). "SNX482 selectively blocks P/Q Ca2+ channels and delays the inactivation of Na+ channels of chromaffin cells". European Journal of Pharmacology (Elsevier BV) 475 (1–3): 11–18. doi:10.1016/s0014-2999(03)02084-3. ISSN 0014-2999. PMID 12954354. 
  4. Kimm, T.; Bean, B. P. (2014-07-09). "Inhibition of A-Type Potassium Current by the Peptide Toxin SNX-482". Journal of Neuroscience (Society for Neuroscience) 34 (28): 9182–9189. doi:10.1523/jneurosci.0339-14.2014. ISSN 0270-6474. PMID 25009251. 
  5. Wang, Gang et al. (1999-11-01). "An R-Type Ca2+Current in Neurohypophysial Terminals Preferentially Regulates Oxytocin Secretion". The Journal of Neuroscience (Society for Neuroscience) 19 (21): 9235–9241. doi:10.1523/jneurosci.19-21-09235.1999. ISSN 0270-6474. PMID 10531427. 
  6. Trevisan, Gabriela; Oliveira, Sara Marchesan (2022). "Animal Venom Peptides Cause Antinociceptive Effects by Voltage-gated Calcium Channels Activity Blockage". Current Neuropharmacology (Bentham Science Publishers Ltd.) 20 (8): 1579–1599. doi:10.2174/1570159x19666210713121217. ISSN 1570-159X. PMID 34259147.