Chemistry:GTx1-15

From HandWiki
Revision as of 09:29, 8 February 2024 by John Stpola (talk | contribs) (correction)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Short description: Toxin from the Chilean tarantula venom


GTx1-15 is a toxin from the Chilean tarantula venom that acts as both a voltage-gated calcium channel blocker and a voltage-gated sodium channel blocker.

Sources

GTx1-15 is derived from the Chilean tarantula species Grammostola rosea and Phrixotrichus scrofa.[1][2][3]

Chemistry

Sequence

GTx1-15 is composed of 34 amino acid residues; its sequence has been determined to be DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCQYVF. This peptide has a molecular weight of approximately 4 kDa and is amidated at its carboxy terminus.[3]

Structure and Family

GTx1-15 belongs to the GTx1 family, which consists of long loop inhibitor cystine knot (ICK) motif toxins.[2] The GTx1-15 peptide has a conserved structure of six cysteine residues with the characteristic ICK motif,[1] which results in proteolytic, thermal, and chemical stability.[4]

Homology

GTx1-15 displays sequence homology with other ion channel toxins from several spider species. It is homologous in sequence with sodium channel blocker PaurTx3 by 76.5%, and it also shares similarities in sequence with HnTx-IV (60%), CcoTx2 (55.9%), TLTx1 (55.6%), ω-GrTx SIA (40%), GsAFII (38.2%) and GsMTx2 (38.2%).[1]

Target and Mode of Action

GTx1-15 targets low-voltage activated cation channels.[1] It specifically inhibits:

The mode of action of GTx1-15 has not yet been clarified.[1]

IC50

The effectiveness of GTx1-15 as a blocker of human cloned Nav and Cav channels is summarized below:[3]

Channels IC50
Cav3.1 0.01 μM
Nav1.7 0.007 μM
Nav1.3 0.12 ± 0.06 μM
Nav1.5 No significant effect (up to 2 μΜ)
Nav1.8 No significant effect (0.93 μM)

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 "Characterization of voltage-dependent calcium channel blocking peptides from the venom of the tarantula Grammostola rosea". Toxicon 58 (3): 265–76. September 2011. doi:10.1016/j.toxicon.2011.06.006. PMID 21740921. 
  2. 2.0 2.1 "Molecular Cloning and Sequence Analysis of the cDNAs Encoding Toxin-Like Peptides from the Venom Glands of Tarantula Grammostola rosea". International Journal of Peptides 2012: 731293. 2012. doi:10.1155/2012/731293. PMID 22500178. 
  3. 3.0 3.1 3.2 3.3 "Two tarantula venom peptides as potent and differential Na(V) channels blockers". Toxicon 77: 58–67. January 2014. doi:10.1016/j.toxicon.2013.10.029. PMID 24211312. 
  4. "High Proteolytic Resistance of Spider-Derived Inhibitor Cystine Knots". International Journal of Peptides 2015: 537508. 2015. doi:10.1155/2015/537508. PMID 26843868.