Biology:C6orf136
C6orf136 (Chromosome 6 Open Reading Frame 136) is a protein in humans (Homo sapiens) encoded by the C6orf136 gene. The gene is conserved in mammals, mollusks, as well some porifera.[1] While the function of the gene is currently unknown, C6orf136 has been shown to be hypermethylated in response to FOXM1 expression in Head Neck Squamous Cell Carcinoma (HNSCC) tissue cells.[2] Additionally, elevated expression of C6orf136 has been associated with improved survival rates in patients with bladder cancer.[3] C6orf136 has three known isoforms.
Gene
Background
C6orf136, also known as DADB-129D20.1, MGC15854, LOC221545, and OTTHUMP00000214979. The gene is a poorly characterized protein coding gene in need of further research. The C6orf136 gene can be accessed on NCBI with accession number NM_001109938.3.
Location
C6orf136 is located on the short arm of chromosome 6 (6p21.33), starting at base pair (bp) 30,647,133 and ending at bp 30,653,207. This gene spans 6,074 bit/s on the plus (+) strand and contains a total of 6 exons.[4]
Gene Neighborhood
Genes in the neighborhood of C6orf136 are the following: ATAT1, PPP1R10, DHX16, PPP1R18, MDC1, MRPS18B, TUBB, and FLOT1.[4]
mRNA
C6orf136 has a total of 3 different isoforms. Isoform 1 is the base version of C6orf136 that encodes for the 315 amino acid protein. Isoform 3 uses an alternate in-frame splice site in the 5' coding region when compared to isoform 1, resulting in isoform 3 being longer than isoform 1. Alternatively, isoform 2 lacks an alternate in-frame exon in the 5' coding region when compared to isoform 1, resulting an isoform 2 being shorter than isoform 1
Protein
General Properties
The sequence for the C6orf136 isoform 1 gene per NCBI is as follows:[5]
MYQPSRGAARRLGPCLRAYQARPQDQLYPGTLPFPPLWPHSTTTTSPSSPLFWSPLPPRLPTQRLPQVPP 70 LPLPQIQALSSAWVVLPPGKGEEGPGPELHSGCLDGLRSLFEGPPCPYPGAWIPFQVPGTAHPSPATPSG 140 DPSMEEHLSVMYERLRQELPKLFLQSHDYSLYSLDVEFINEILNIRTKGRTWYILSLTLCRFLAWNYFAH 210 LRLEVLQLTRHPENWTLQARWRLVGLPVHLLFLRFYKRDKDEHYRTYDAYSTFYLNSSGLICRHRLDKLM 280 PSHSPPTPVKKLLVGALVALGLSEPEPDLNLCSKP 315
The bolded region in this sequence indicates a domain of unknown function (DUF2358) found in all three isoforms of C6orf136.
The C6orf136 protein has a molecular weight of 35.8 kD and an isoelectric point of 8.99, making the protein slightly basic and physiological pH.
Domains
DUF2358 is a domain of unknown function found within the C6orf136 protein from aa149 to aa274.[6] This domain is highly conserved in the C-terminus region and is evolutionarily conserved from plants to humans.[7] Additionally, a proline rich domain was also predicted from aa29 to aa142 of the human C6orf136 protein.[6]

Structure
Secondary Structure
The conserved DUF2358 domain of C6orf136 contains an equal mix of alpha helices and beta sheets interspersed in that region.[8][9][10] The N-terminus of the protein contained primarily alpha helices, but was poorly conserved across species.
Tertiary Structure
The tertiary structure illustrates a primarily alpha helices in the N-terminus of the protein loosely wound up, followed by a densely packed and folded region correlating to the DUF2358 domain with a mix of alpha helices and beta sheets as determined by I-TASSER.[11][12][13]
Regulation
Gene Regulation
Promotor
C6orf136 has 5 predicted promotor regions. The GXP_6051617 promotor had the largest number of transcripts and CAGE tags. It's located on the plus (+) strand, starts at position 30646644, ends at position 30647460, and is 817 bp in length. It also has 12 total coding transcripts.[14]

| Promotor ID | Start Position | End Position | Length | # of Coding Transcripts |
|---|---|---|---|---|
| GXP_6051617 (+) | 30646644 | 30647460 | 817 | 12 |
| GXP_2563514 (+) | 30648906 | 30649945 | 1040 | 1 |
| GXP_6051618 (+) | 30650054 | 30651093 | 1040 | 1 |
| GXP_6051619 (+) | 30650266 | 30651423 | 1158 | 2 |
| GXP_3204858 (+) | 30651611 | 30652650 | 1040 | 0 |
Transcription Factor Binding Sites
The following table highlights the most likely transcription factors binding to the GXP_6051617 promotor for C6orf136.[14]
| Matrix Family | Detailed Family Information |
|---|---|
| V$ZF15 | C2H2 zinc finger transcription factors 15 |
| V$NRF1 | Nuclear respiratory factor 1 |
| V$MYBL | Cellular and viral myb-like transcriptional regulators |
| V$CALM | Calmodulin-binding transcription factors |
| V$ZF07 | C2H2 zinc finger transcription factors 7 |
| V$ZF5F | ZF5 POZ domain zinc finger |
| V$HAND | Twist subfamily of class B bHLH transcription factors |
| V$KLFS | Krueppel like transcription factors |
| V$SP1F | GC-Box factors SP1/GC |
| V$EGRF | EGR/nerve growth factor induced protein C & related factors |
| V$PLAG | Pleomorphic adenoma gene |
| V$EBOX | E-box binding factors |
| V$RXRF | RXR heterodimer binding sites |
| V$RREB | Ras-responsive element binding protein |
| V$NKXH | NKX homeodomain factors |
| V$ETSF | Human and murine ETS1 factors |
| V$CEBP | Ccaat/Enhancer Binding Protein |
Expression Pattern
C6orf136 is expressed highly in the heart, intestine, brain, and kidney tissue.[4] According to AceView, it is well expressed at 1.3x the average gene expression.[15]
Transcription Regulation
Stem Loop Prediction
The 3’ UTR sequence had a total of 7 step loops with a single site for potential miRNA binding. In contrast, the 5’ UTR had only 2 stem loops and contained no other notable regions.[16]
miRNA Targeting
TargetScan indicated a single has-miRNA-585-3p miRNA binding site in the 3' UTR, shown to be associated with tumor-suppressing properties with respect to gastric cancer.[17][18]
Protein Regulation
Subcellular Localization
C6orf136 is predicted to be localized primarily in the nucleus in Homo sapiens, but is predicted to be primarily expressed in the mitochondria in other species.[19]
Post-Translational Modification
The C6orf136 gene has 8 predicted kinase-specific phosphorylation sites at positions 5, 28, 137, 139, 191, 256, 261, and 303, where 4 of the phosphorylation sites are serines, 3 sites are threonines, and 1 is a tryptophan.[20] Additionally, the protein also has a single predicted SUMOylation site at position 247 on a lysine with a p-value of 0.063.[21]
Homology
Paralogs

No paralogs of C6orf136 have been detected in the human genome.
Orthologs
Below is a table of selected orthologs of the C6orf136 gene, including closely and distantly related orthologs.[22] C6orf136 has evolved moderately and evenly over time with a rate faster than Cytochrome C but slower than Fibrinogen Alpha.
| Genus and species | Common name | Taxon Class | Date of Divergence (MYA) | Accession # | Length (AA) | % Identity with Human | % Similarity with Human |
|---|---|---|---|---|---|---|---|
| Homo sapiens | Humans | Primates | 0 | NP_001103408.1 | 315 | 100% | 100% |
| Pan troglodytes | Chimpanzee | Primates | 6.4 | PNI76372.1 | 315 | 100% | 100% |
| Mus musculus | Mouse | Rodentia | 89 | EDL23245.1 | 315 | 80% | 87% |
| Chiroxiphia lanceolata | Lance-tailed manakin | Passerine | 318 | XP_032533412.1 | 384 | 60% | 76% |
| Chelonia mydas | Sea Turtle | Testudines | 318 | XP_007068287.2 | 386 | 63% | 74% |
| Gopherus evgoodei | Gopher tortoise | Testudines | 318 | XP_030399707.1 | 320 | 60% | 72% |
| Melopsittacus undulatus | Parakeet | Psittaciformes | 318 | XP_033929477.1 | 288 | 61% | 76% |
| Geotrypetes seraphini | Gaboon caecilian | Gymnophiona | 351.7 | XP_033771275.1 | 416 | 56% | 70% |
| Danio rerio | Zebrafish | Cypriniformes | 433 | NP_001076315.1 | 423 | 49% | 70% |
| Apostichopus japonicus | Sea cucumber | Synallactida | 627 | PIK49576.1 | 376 | 41% | 59% |
| Strongylocentrotus purpuratus | Sea Urchin | Echinoida | 627 | XP_030853574.1 | 518 | 38% | 56% |
| Branchiostoma floridae | Lancelet | Lancelet | 637 | XP_035683876.1 | 460 | 45% | 64% |
| Aplysia californica | Sea hare | Aplysiidae | 736 | XP_005104721.2 | 409 | 25% | 50% |
| Anopheles darlingi | Malaria mosquito | Diptera | 736 | ETN63757.1 | 303 | 36% | 53% |
| Crassostrea virginica | Oyster | Ostreoida | 736 | XP_022320078.1 | 359 | 27% | 44% |
| Ixodes scapularis | Ticks | Ixodida | 736 | XP_029848376.1 | 352 | 35% | 51% |
| Mytilus coruscus | hard-shelled mussel | Mytilida | 736 | CAC5413351.1 | 363 | 33% | 59% |
| Pomacea canaliculata | Channeled applesnail | Mollusca | 736 | XP_025112199.1 | 286 | 24% | 39% |
| Wasmannia auropunctata | Electric ant | Hymenoptera | 736 | XP_011701036.1 | 387 | 36% | 56% |
| Trichoplax adhaerens | Trichoplax | Tricoplaciformes | 747 | XP_002109420.1 | 415 | 34% | 57% |
| Amphimedon queenslandica | Porifera | Porifera | 777 | XP_019852039.1 | 303 | 33% | 7% |
Function
| Protein | Function | Method | Databases Present in | Total # of appearances |
|---|---|---|---|---|
| CSNK2B | Localized to ER and Golgi, and involved with regulating metabolic pathways, signal transduction, transcription, translation, and replication.[23] | Y2H | iRefIndex; MINT; IMEx; mentha | 13 |
| PLK1 | Regulates cell cycle, specifically G2/M transition. Loss of PLK1 expression can induce pro-apoptotic pathways. This is being studied as a target for cancer drugs, specifically colon and lung cancers that are dependent on PLK1. (Oncogene). Also possible leukemia involvement.[24] | Y2H | iRefIndex; MINT; InnateDB-ALL; IMEx; mentha | 11 |
| RBM8A | Found predominantly in nucleus, but also in cytoplasm. Is associated with the mRNAs produced after splicing, and is thought to act as a tag to indicate where introns were present, thus coupling pre- and post-mRNA binding events.[25] | Y2H; Affinity Chromotography; Anti-Tag Coimmunoprecipitation | iRefIndex; InnateDB-All; MatrixDB; IntAct; IMEx; metha | 6 |
| KIF21A | Kinesin-like protein (motor protein). Could be involved in microtubule dependent transport. Mutation of this gene results in fibrosis of extraocular muscles. Not much else is currently known about this gene.[26] | Affinity Chromotography; Anti-Tag Coimmunoprecipitation | MatrixDB; IntAct; IMEx; mentha | 4 |
| FBXW7 | Gene that encodes for many proteins in the F-box protein family. Mutations in this gene are associated with a variety of cancers (cholangiocarcinoma, Endometrial carcinoma, colorectal carcinoma, bladder cancer, gastric carcinoma, lung squamous cell carcinoma, etc.). Thus it's likely that this gene plays a role in the pathogenesis of human cancers.[27] | Genetic Interference | InnateDB- | 1 |
References
- ↑ "C6orf136 orthologs" (in en). https://www.ncbi.nlm.nih.gov/gene/221545/ortholog/.
- ↑ "Identification of FOXM1-induced epigenetic markers for head and neck squamous cell carcinomas". Cancer 119 (24): 4249–58. December 2013. doi:10.1002/cncr.28354. PMID 24114764.
- ↑ "Cancer stem cell-specific expression profiles reveal emerging bladder cancer biomarkers and identify circRNA_103809 as an important regulator in bladder cancer". Aging 12 (4): 3354–3370. February 2020. doi:10.18632/aging.102816. PMID 32065779.
- ↑ 4.0 4.1 4.2 "C6orf136 chromosome 6 open reading frame 136 [Homo sapiens (human) - Gene - NCBI"]. https://www.ncbi.nlm.nih.gov/gene/221545.
- ↑ "uncharacterized protein C6orf136 isoform 1 [Homo sapiens - Protein - NCBI"]. https://www.ncbi.nlm.nih.gov/protein/NP_001103408.1.
- ↑ 6.0 6.1 "Motif Scan" (in en). https://myhits.sib.swiss/cgi-bin/motif_scan.
- ↑ "Pfam: Family: DUF2358 (PF10184)". http://pfam.xfam.org/family/DUF2358.
- ↑ "I-TASSER server for protein structure and function prediction". https://zhanglab.ccmb.med.umich.edu/I-TASSER/.
- ↑ "PHYRE2 Protein Fold Recognition Server". http://www.sbg.bio.ic.ac.uk/~phyre2/html/page.cgi?id=index.
- ↑ "Bioinformatics Toolkit". https://toolkit.tuebingen.mpg.de/tools/ali2d.
- ↑ "I-TASSER: a unified platform for automated protein structure and function prediction". Nature Protocols 5 (4): 725–38. April 2010. doi:10.1038/nprot.2010.5. PMID 20360767.
- ↑ "I-TASSER server: new development for protein structure and function predictions". Nucleic Acids Research 43 (W1): W174-81. July 2015. doi:10.1093/nar/gkv342. PMID 25883148.
- ↑ "The I-TASSER Suite: protein structure and function prediction". Nature Methods 12 (1): 7–8. January 2015. doi:10.1038/nmeth.3213. PMID 25549265.
- ↑ 14.0 14.1 "Genomatix - NGS Data Analysis & Personalized Medicine". https://www.genomatix.de/index.html.
- ↑ "AceView: Gene:C6orf136, a comprehensive annotation of human, mouse and worm genes with mRNAs or ESTsAceView.". https://www.ncbi.nlm.nih.gov/ieb/research/acembly/av.cgi?db=human&term=c6orf136&submit=Go.
- ↑ "miRDB - MicroRNA Target Prediction Database". http://www.mirdb.org.
- ↑ "TargetScanHuman 7.2". http://www.targetscan.org/vert_72/.
- ↑ "The colorectal microRNAome". Proceedings of the National Academy of Sciences of the United States of America 103 (10): 3687–92. March 2006. doi:10.1073/pnas.0511155103. PMID 16505370. Bibcode: 2006PNAS..103.3687C.
- ↑ "PSORT II Prediction". https://psort.hgc.jp/form2.html.
- ↑ "GPS 5.0 - Kinase-specific Phosphorylation Site Prediction". http://gps.biocuckoo.cn/online.php.
- ↑ "GPS-SUMO: Prediction of SUMOylation Sites & SUMO-interaction Motifs". http://sumosp.biocuckoo.org/online.php.
- ↑ "Protein BLAST: search protein databases using a protein query". https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome.
- ↑ "CSNK2B Gene - GeneCards | CSK2B Protein | CSK2B Antibody". https://www.genecards.org/cgi-bin/carddisp.pl?gene=CSNK2B.
- ↑ "PLK1 Gene - GeneCards | PLK1 Protein | PLK1 Antibody". https://www.genecards.org/cgi-bin/carddisp.pl?gene=PLK1.
- ↑ "RBM8A Gene - GeneCards | RBM8A Protein | RBM8A Antibody". https://www.genecards.org/cgi-bin/carddisp.pl?gene=RBM8A.
- ↑ "KIF21A Gene - GeneCards | KI21A Protein | KI21A Antibody". https://www.genecards.org/cgi-bin/carddisp.pl?gene=KIF21A.
- ↑ "FBXW7 Gene - GeneCards | FBXW7 Protein | FBXW7 Antibody". https://www.genecards.org/cgi-bin/carddisp.pl?gene=FBXW7.
