Biology:Candidate division SR1 and gracilibacteria code
The candidate division SR1 and gracilibacteria code (translation table 25) is used in two groups of (so far) uncultivated bacteria found in marine and fresh-water environments and in the intestines and oral cavities of mammals among others.[1] The difference to the standard and the bacterial code is that UGA represents an additional glycine codon and does not code for termination.[2]
The code
AAs = FFLLSSSSYY**CCGWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = ---M-------------------------------M---------------M------------
Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG
Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).
Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V).
Difference from the standard code
DNA codon | RNA codon | This code (25) | Standard code (1) | |
---|---|---|---|---|
TGA | UGA | Gly (G) | STOP = Ter (*) |
Initiation codons
- AUG, GUG, UUG
Systematic range
- Candidate Division SR1
- Gracilibacteria
See also
References
This article incorporates text from the United States National Library of Medicine, which is in the public domain. [3]
- ↑ Davis, James P.; Youssef, Noha H.; Elshahed, Mostafa S. (June 2009). "Assessment of the diversity, abundance, and ecological distribution of members of candidate division SR1 reveals a high level of phylogenetic diversity but limited morphotypic diversity". Applied and Environmental Microbiology 75 (12): 4139–4148. doi:10.1128/AEM.00137-09. ISSN 1098-5336. PMID 19395567. Bibcode: 2009ApEnM..75.4139D.
- ↑ J. H. Campbell; O'P. Donoghue; A. G. Campbell; P. Schwientek; A. Sczyrba; T. Woyke; D. Söll; M. Podar (2 April 2013). "UGA is an additional glycine codon in uncultured SR1 bacteria from the human microbiota". Proc Natl Acad Sci U S A 110 (14): 5540–5. doi:10.1073/pnas.1303090110. PMID 23509275. Bibcode: 2013PNAS..110.5540C.
- ↑ Elzanowski, Andrzej; Ostell, Jim; Leipe, Detlef; Soussov, Vladimir. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop.
Original source: https://en.wikipedia.org/wiki/Candidate division SR1 and gracilibacteria code.
Read more |