Biology:Scenedesmus obliquus mitochondrial code

From HandWiki
Short description: An alternative genetic code found in the mitochondrial genome of some green algae


The Scenedesmus obliquus mitochondrial code (translation table 22) is a genetic code found in the mitochondria of Scenedesmus obliquus, a species of green algae.[1]

Code

   AAs = FFLLSS*SYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine|Glutamine (Gln, Q), Glycine (Gly, G), [[Chemistry:Histidine|Histidine]] (His, H), [[Chemistry:Isoleucine (Ile, I), [[Chemistry:Leucine|Leucine]] (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine|Tyrosine|Tyrosine|Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

DNA codons RNA codons This code (22) Standard code (1)
TCA UCA STOP = Ter (*) Ser (S)
TAG UAG Leu (L) STOP = Ter (*)

Systematic range and comments

See also

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. [2]

  1. Jump up to: 1.0 1.1 A. M. Nedelcu, R. W. Lee, G. Lemieux, M. W. Gray, G. Burger (June 2000). "The complete mitochondrial DNA sequence of Scenedesmus obliquus reflects an intermediate stage in the evolution of the green algal mitochondrial genome". Genome Research 10 (6): 819–31. doi:10.1101/gr.10.6.819. PMID 10854413. 
  2. Elzanowski, Andrzej; Ostell, Jim; Leipe, Detlef; Soussov, Vladimir. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop.