Biology:The euplotid nuclear code

From HandWiki

The euplotid nuclear code (translation table 10) is the genetic code used by Euplotidae.

The code

   AAs = FFLLSSSSYY**CCCWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

Starts = -----------------------------------M----------------------------

 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine|Glutamine (Gln, Q), Glycine (Gly, G), [[Chemistry:Histidine|Histidine]] (His, H), [[Chemistry:Isoleucine (Ile, I), [[Chemistry:Leucine|Leucine]] (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine|Tyrosine|Tyrosine|Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code:
This code Standard
UGA Cys C Ter *

Systematic range

  • Ciliata: Euplotidae[1]

See also

References

  • This article contains public domain text from the NCBI page compiled by Andrzej (Anjay) Elzanowski and Jim Ostell.[2]
  1. D. C. Hoffman; R. C. Anderson; M. L. DuBois; D. M. Prescott (25 April 1995). "Macronuclear gene-sized molecules of hypotrichs". Nucleic Acids Res 23 (8): 1279–83. doi:10.1093/nar/23.8.1279. PMID 7753617. 
  2. The Genetic Codes Accessed 19 March 2016