Biology:Acetolactate synthase
| acetolactate synthase | |||||||||
|---|---|---|---|---|---|---|---|---|---|
 Crystal structure of Arabidopsis thaliana acetohydroxyacid synthase complexed with a sulfonylurea herbicide, metsulfuron-methyl.[1] | |||||||||
| Identifiers | |||||||||
| EC number | 2.2.1.6 | ||||||||
| CAS number | 9027-45-6 | ||||||||
| Alt. names | pyruvate:pyruvate acetaldehydetransferase (decarboxylating) | ||||||||
| Databases | |||||||||
| IntEnz | IntEnz view | ||||||||
| BRENDA | BRENDA entry | ||||||||
| ExPASy | NiceZyme view | ||||||||
| KEGG | KEGG entry | ||||||||
| MetaCyc | metabolic pathway | ||||||||
| PRIAM | profile | ||||||||
| PDB structures | RCSB PDB PDBe PDBsum | ||||||||
| Gene Ontology | AmiGO / QuickGO | ||||||||
| |||||||||
The acetolactate synthase (ALS) enzyme (also known as acetohydroxy acid or acetohydroxyacid synthase, abbr. AHAS)[2] is a protein found in plants and micro-organisms. ALS catalyzes the first step in the synthesis of the branched-chain amino acids (valine, leucine, and isoleucine).[3]
A human protein of yet unknown function, sharing some sequence similarity with bacterial ALS, is encoded by the ILVBL (ilvB-like) gene.[4]
Structure
Gene
Human ILVBL gene has 17 exons resides on chromosome 19 at q13.1.[5]
Protein
The catalytic peptide of ALS in Arabidopsis thaliana (mouse-eared cress) is a chloroplastic protein consisting of 670 residues, the last 615 of which form the active form. Three main domains are found, with two thiamine pyrophosphate sandwiching a DHS-like NAD/FAD-binding domain.[6] In SCOP assignment, these subunits are named d1yhya1, d1yhya2, and d1yhya3 from the N-terminal to the C-termianl.[7]
The structure of acetolactate synthase that was used for the picture on this page was determined using X-ray diffraction at 2.70 angstroms. X-ray diffraction uses X-rays at specified wavelengths to produce patterns, as the X–ray is scattered in certain ways that give an idea to the structure of the molecule being analyzed.
There are five specific ligands that interact with this protein. The five are listed below.
| Ligand Identifier | Name | Structure |
|---|---|---|
| P22 | ETHYL DIHYDROGEN DIPHOSPHATE | C2H8O7P2 |
| NHE | 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID | C8H17NO3S |
| Mg | Magnesium Ion | Mg |
| FAD | FLAVIN-ADENINE DINUCLEOTIDE | C27H33N9O15P2 |
| 1SM | METHYL 2-[({[(4,6-DIMETHYLPYRIMIDIN-2-YL)AMINO]CARBONYL}AMINO)SULFONYL]BENZOATE | C15H16N4O5 S |
The FAD bound is not catalytic.
Function
Acetolactate synthase is catalytic enzyme involved in the biosynthesis of various amino acids. This enzyme has the Enzyme Commission Code is 2.2.1.6, which means that the enzyme is a transketolase or a transaldolase, which is classified under the transferases that transfer aldehyde or ketone residues. In this case, acetolactate synthase is a transketolase, which moves back and forth, having both catabolic and anabolic forms. These act on a ketone (pyruvate) and can go back and forth in the metabolic chain. These are found in humans, animals, plants, and bacteria. In plants, they are located in the chloroplasts in order to help with the metabolic processes.[6] In baker's yeast, they are located in the mitochondria.[8] In several experiments, it has been shown that mutated strains of Escherichia coli K-12 without the enzyme were not able to grow in the presence of only acetate or oleate as the only carbon sources.[9]
A catabolic version that does not bind FAD (InterPro: IPR012782) is found in some bacteria.
Catalytic activity
Acetolactate synthase, also known as acetohydroxy acid synthase, is an enzyme specifically involved in the conversion of pyruvate to acetolactate:
- 2 CH3COCO2− → −O2CC(OH)(CH3)COCH3 + CO2
The reaction uses thiamine pyrophosphate in order to link the two pyruvate molecules. The resulting product of this reaction, acetolactate, eventually becomes valine, leucine, and isoleucine. All three of these amino acids are essential amino acids and cannot be synthesized by humans. This also leads to the systemic name pyruvate:pyruvate acetaldehydetransferase (decarboxylating). This enzyme is the first of several enzymes in the biosynthesis cycle for leucine and valine, taking the initial pyruvate molecules and starting the conversion from pyruvic acid to the amino acids. The specific residue that is responsible for this is a glycine at position 511 in the protein. This is the one that requires a cofactor of TPP for its function.
Four specific residues are responsible for catalytic activity in this enzyme. They are listed here with cofactors required written after.
| Residue | Position | Cofactors |
|---|---|---|
| Valine | 485 | HE3 |
| Methionine | 513 | HE3 |
| Histidine | 643 | - |
| Glycine | 511 | TPP |
The primary sequence of this protein in Arabidopsis is listed below. Residues involved in catalytic activity are bolded. Mutagenesis of Asp428, which is crucial carboxylate ligand to Mg(2+) in the "ThDP motif", leads to a decrease in the affinity of AHAS II for Mg(2+). While mutant D428N shows ThDP affinity close to that of the wild-type on saturation with Mg(2+), D428E has a decreased affinity for ThDP. These mutations also lead to dependence of the enzyme on K(+).[10]
>sp|P1759|86-667 TFISRFAPDQPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLADALLD SVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQLAIPNWEQAMRLPGYMSRMPKPPE DSHLEQIVRLISESKKPVLYVGGGCLNSSDELGRFVELTGIPVASTLMGLGSYPXDDELSLHMLGMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAF ASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKLDFGVWRNELNVQKQKFPLSFKTFGEAIPPQYAIKVLDELTDGKAIISTGV GQHQMWAAQFYNYKKPRQWLSSGGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVENLPVKVLLLNNQHLGMVMQWEDRFYKANRAH TFLGDPAQEDEIFPNMLLFAAACGIPAARVTKKADLREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFNDVITEGDGR
Because of inhibition and several factors it is a slow procedure.
Regulation
In Arabidopsis, two chains of catalytic ALS (InterPro: IPR012846) is complexed with two regulatory small subunits (InterPro: IPR004789), VAT1 and At2g31810.[12][13] Such an arrangement is widespread in both bacterial and eukaryotic ALS. The hetromeric structure was demonstrated in E. coli in 1984 and in eukaryotes (S. cerevisiae and Porphyra purpurea) in 1997.[14] Most of the regulatory proteins have an ACT domain (InterPro: IPR002912) and some of them have a NiKR-like C-terminal (InterPro: IPR027271).
In bacteria (E. coli)), Acetolactate synthase consists of three pairs of isoforms. Each pair includes a large subunit, which is thought to be responsible for catalysis, and a small subunit for feedback inhibition. Each subunit pair, or ALS I, II, and III respectively, is located on its own operon, ilvBN, ilvGM and ilvIH (where ilvN regulated ilvB, and vice versa). Together, these operons code for several enzymes involved in branched-chain amino acid biosynthesis. Regulation is different for each operon.[15]
The ilvGMEDA operon encodes the ilvGM (ALS II) pair as well as a branched-chain-amino-acid transaminase (ilvE), dihydroxy-acid dehydratase (ilvD), and threonine ammonia-lyase (ilvA). It is regulated by feedback inhibition in the form of transcriptional attenuation. That is, transcription is reduced in the presence of the pathway's end-products, the branched-chain amino acids.
The ilvBNC operon encodes the ilvBN (ALS I) pair and a ketol-acid reductoisomerase (ilvC). It is similarly regulated, but is specific to isoleucine and leucine; valine does not affect it directly.
Both the ilvGMEDA and ilvBNC operons are derepressed during shortages of the branched-chain amino acids by the same mechanism that represses them. Both of these operons as well as the third, ilvIH, are regulated by leucine-responsive protein (Lrp).[16][17]
Inhibitors
Clinical significance
CADASIL, an identified autosomal dominant condition characterized by the recurrence of subcortical infarcts leading to dementia, was previously mapped to “ILVBL” gene within a 2-cM interval, D19S226–D19S199. This gene encodes a protein highly similar to the acetolactate synthase of other organisms. No recombination event was observed with D19S841, a highly polymorphic microsatellite marker isolated from a cosmid mapped to this region. No mutation was detected on this gene in CADASIL patients, suggesting that it is not implicated in this disorder.[4]
Interactions
In the study of Escherichia coli, the FAD binding domain of ilvB has been shown to interact with ilvN and activate the AHAS I enzyme.[18]
References
- ↑ PDB: 1YHY; "Herbicide-binding sites revealed in the structure of plant acetohydroxyacid synthase". Proceedings of the National Academy of Sciences of the United States of America 103 (3): 569–73. January 2006. doi:10.1073/pnas.0508701103. PMID 16407096. Bibcode: 2006PNAS..103..569M.
- ↑ "Evolution in action: plants resistant to herbicides". Annual Review of Plant Biology (Annual Reviews) 61 (1): 317–47. 2010-06-02. doi:10.1146/annurev-arplant-042809-112119. PMID 20192743.
- ↑ "Biosynthesis of 2-aceto-2-hydroxy acids: acetolactate synthases and acetohydroxyacid synthases". Biochimica et Biophysica Acta (BBA) - Protein Structure and Molecular Enzymology 1385 (2): 401–19. June 1998. doi:10.1016/S0167-4838(98)00083-1. PMID 9655946.
- ↑ 4.0 4.1 "A human homolog of bacterial acetolactate synthase genes maps within the CADASIL critical region". Genomics 38 (2): 192–8. December 1996. doi:10.1006/geno.1996.0615. PMID 8954801.
- ↑ "Entrez Gene:ILVBL ilvB (bacterial acetolactate synthase)-like". https://www.ncbi.nlm.nih.gov/gene/10994.
- ↑ 6.0 6.1 "Acetolactate synthase, chloroplastic (P17597) < InterPro < EMBL-EBI". https://www.ebi.ac.uk/interpro/protein/P17597.
- ↑ "SCOPe 2.07: Structural Classification of Proteins — extended". http://scop.berkeley.edu/pdb/code=1YHY.
- ↑ "ILV2 - Acetolactate synthase catalytic subunit, mitochondrial precursor - Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) - ILV2 gene & protein". https://www.uniprot.org/uniprot/P07342.
- ↑ "Acetohydroxy acid synthase I, a required enzyme for isoleucine and valine biosynthesis in Escherichia coli K-12 during growth on acetate as the sole carbon source". Journal of Bacteriology 165 (2): 453–60. February 1986. doi:10.1128/jb.165.2.453-460.1986. PMID 3511034.
- ↑ "Binding and activation of thiamin diphosphate in acetohydroxyacid synthase". Biochemistry 40 (39): 11946–54. October 2001. doi:10.1021/bi0104524. PMID 11570896.
- ↑ "ALS - Acetolactate synthase, chloroplastic precursor - Arabidopsis thaliana (Mouse-ear cress) - ALS gene & protein". https://www.uniprot.org/uniprot/P17597.
- ↑ "Genetic analysis of pathway regulation for enhancing branched-chain amino acid biosynthesis in plants". The Plant Journal 63 (4): 573–83. August 2010. doi:10.1111/j.1365-313X.2010.04261.x. PMID 20497381.
- ↑ "Identification of the regulatory subunit of Arabidopsis thaliana acetohydroxyacid synthase and reconstitution with its catalytic subunit". Biochemistry 40 (23): 6836–44. June 2001. doi:10.1021/bi002775q. PMID 11389597.
- ↑ "Identification of an acetolactate synthase small subunit gene in two eukaryotes". Gene 190 (2): 245–9. May 1997. doi:10.1016/s0378-1119(97)00002-4. PMID 9197540.
- ↑ "The amino acid valine is secreted in continuous-flow bacterial biofilms". Journal of Bacteriology 190 (1): 264–74. January 2008. doi:10.1128/JB.01405-07. PMID 17981982.
- ↑ "The leucine-responsive regulatory protein, a global regulator of metabolism in Escherichia coli". Microbiological Reviews 58 (3): 466–90. September 1994. doi:10.1128/mmbr.58.3.466-490.1994. PMID 7968922.
- ↑ "Branched-chain amino acids.". Amino Acid Biosynthesis: Pathways, Regulation and Metabolic Engineering. Microbiology Monographs. 5. Berlin, Heidelberg: Springer. 2007. pp. 129–162. doi:10.1007/7171_2006_070. ISBN 978-3-540-48596-4.
- ↑ "Escherichia coli ilvN interacts with the FAD binding domain of ilvB and activates the AHAS I enzyme". Biochemistry 47 (6): 1518–31. February 2008. doi:10.1021/bi701893b. PMID 18193896.
External links
- Acetolactate+synthase at the US National Library of Medicine Medical Subject Headings (MeSH)
- Ramachandran plot [1]
- [2][yes|permanent dead link|dead link}}]
 |  |
