Biology:List of human transcription factors

From HandWiki
Short description: none

This list of manually curated human transcription factors is taken from Lambert, Jolma, Campitelli et al.[1]
It was assembled by manual curation.
More detailed information is found in the manuscript and the web site accompanying the paper (Human Transcription Factors)

List of human transcription factors (1639)

Gene ID DBD Motif status (Feb 2018)
(Link to human TFs annotation)
IUPAC consensus
(from selected PWM)
AC008770.3 ENSG00000267179 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1]
AC023509.3 ENSG00000267281 bZIP Known motif – from protein with 100% identical DBD – in vitro [2] RTGACGTCAY
AC092835.1 ENSG00000233757 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [3]
AC138696.1 ENSG00000264668 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [4] RYGGAGAGTTAGC
ADNP ENSG00000101126 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [5]
ADNP2 ENSG00000101544 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [6]
AEBP1 ENSG00000106624 Unknown Likely sequence specific TF according to literature or domain structure – No motif [7]
AEBP2 ENSG00000139154 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [8]
AHCTF1 ENSG00000153207 AT hook Likely sequence specific TF according to literature or domain structure – No motif [9]
AHDC1 ENSG00000126705 AT hook Likely sequence specific TF according to literature or domain structure – No motif [10]
AHR ENSG00000106546 bHLH Known motif – In vivo/Misc source [11] BKNGCGTGHV
AHRR ENSG00000063438 bHLH Inferred motif from similar protein – In vivo/Misc source [12] BKNGCGTGHV
AIRE ENSG00000160224 SAND Known motif – In vivo/Misc source [13] HNNGGWWNWDWWGGDBDH
AKAP8 ENSG00000105127 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [14]
AKAP8L ENSG00000011243 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [15]
AKNA ENSG00000106948 AT hook Likely sequence specific TF according to literature or domain structure – No motif [16]
ALX1 ENSG00000180318 Homeodomain Known motif – High-throughput in vitro [17] TAATYTAATTA
ALX3 ENSG00000156150 Homeodomain Known motif – High-throughput in vitro [18] TAATTR
ALX4 ENSG00000052850 Homeodomain Known motif – High-throughput in vitro [19] TAATYNRRTTA
ANHX ENSG00000227059 Homeodomain Known motif – High-throughput in vitro [20] KTKACAWG
ANKZF1 ENSG00000163516 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [21]
AR ENSG00000169083 Nuclear receptor Known motif – High-throughput in vitro [22] RGGWACRHBDYGTWCYH
ARGFX ENSG00000186103 Homeodomain Known motif – High-throughput in vitro [23] DYTAATTAR
ARHGAP35 ENSG00000160007 Unknown Likely sequence specific TF according to literature or domain structure – No motif [24]
ARID2 ENSG00000189079 ARID/BRIGHT; RFX Likely sequence specific TF according to literature or domain structure – No motif [25]
ARID3A ENSG00000116017 ARID/BRIGHT Known motif – from protein with 100% identical DBD – in vitro [26] DATHAAD
ARID3B ENSG00000179361 ARID/BRIGHT Inferred motif from similar protein – High-throughput in vitro [27] WWTTAATH
ARID3C ENSG00000205143 ARID/BRIGHT Inferred motif from similar protein – High-throughput in vitro [28] DATHAAD
ARID5A ENSG00000196843 ARID/BRIGHT Known motif – from protein with 100% identical DBD – in vitro [29] HAATATTD
ARID5B ENSG00000150347 ARID/BRIGHT Known motif – from protein with 100% identical DBD – in vitro [30] DATWH
ARNT ENSG00000143437 bHLH Known motif – from protein with 100% identical DBD – in vitro [31] KCACGTGM
ARNT2 ENSG00000172379 bHLH Known motif – High-throughput in vitro [32] RDCACGTGM
ARNTL ENSG00000133794 bHLH Known motif – High-throughput in vitro [33] GTCACGTGAC
ARNTL2 ENSG00000029153 bHLH Inferred motif from similar protein – High-throughput in vitro [34] CACGTGAY
ARX ENSG00000004848 Homeodomain Known motif – High-throughput in vitro [35] TAATYNRATTA
ASCL1 ENSG00000139352 bHLH Known motif – High-throughput in vitro [36] RCASSTGY
ASCL2 ENSG00000183734 bHLH Known motif – High-throughput in vitro [37] RCAGCTGY
ASCL3 ENSG00000176009 bHLH Inferred motif from similar protein – High-throughput in vitro [38] RCASSTGY
ASCL4 ENSG00000187855 bHLH Inferred motif from similar protein – High-throughput in vitro [39] RCASSTGY
ASCL5 ENSG00000232237 bHLH Inferred motif from similar protein – High-throughput in vitro [40] RCASSTGY
ASH1L ENSG00000116539 AT hook Likely sequence specific TF according to literature or domain structure – No motif [41]
ATF1 ENSG00000123268 bZIP Known motif – In vivo/Misc source [42] VTGACGTSAV
ATF2 ENSG00000115966 bZIP Known motif – High-throughput in vitro [43] VTKACGTMAB
ATF3 ENSG00000162772 bZIP Known motif – High-throughput in vitro [44] RTGACGTCAY
ATF4 ENSG00000128272 bZIP Known motif – High-throughput in vitro [45] RKATGACGTCATMY
ATF5 ENSG00000169136 bZIP Known motif – In vivo/Misc source [46] WAAGGRAGARR
ATF6 ENSG00000118217 bZIP Known motif – High-throughput in vitro [47] YKRTGACGTGGCA
ATF6B ENSG00000213676 bZIP Known motif – High-throughput in vitro [48] RTGACGTGGCR
ATF7 ENSG00000170653 bZIP Known motif – High-throughput in vitro [49] DRTGACGTCAT
ATMIN ENSG00000166454 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [50]
ATOH1 ENSG00000172238 bHLH Known motif – High-throughput in vitro [51] RACAGCTGYY
ATOH7 ENSG00000179774 bHLH Known motif – High-throughput in vitro [52] RVCATATGBT
ATOH8 ENSG00000168874 bHLH Inferred motif from similar protein – High-throughput in vitro [53] AAWTANNNBRMCATATGKY
BACH1 ENSG00000156273 bZIP Known motif – In vivo/Misc source [54] RTGACTCAGCANWWH
BACH2 ENSG00000112182 bZIP Known motif – High-throughput in vitro [55] WDNSATGASTCATGNWW
BARHL1 ENSG00000125492 Homeodomain Known motif – High-throughput in vitro [56] TAAWYG
BARHL2 ENSG00000143032 Homeodomain Known motif – High-throughput in vitro [57] TAAWBG
BARX1 ENSG00000131668 Homeodomain Known motif – High-throughput in vitro [58] TAATBGNWWWTTAATBR
BARX2 ENSG00000043039 Homeodomain Known motif – High-throughput in vitro [59] TAAYKRTTWW
BATF ENSG00000156127 bZIP Known motif – High-throughput in vitro [60] VVYGMCAC
BATF2 ENSG00000168062 bZIP Likely sequence specific TF according to literature or domain structure – No motif [61]
BATF3 ENSG00000123685 bZIP Known motif – High-throughput in vitro [62] VTGACGTCAYV
BAZ2A ENSG00000076108 MBD; AT hook Likely sequence specific TF according to literature or domain structure – No motif [63]
BAZ2B ENSG00000123636 MBD Likely sequence specific TF according to literature or domain structure – No motif [64]
BBX ENSG00000114439 HMG/Sox Known motif – High-throughput in vitro [65] TGAWCDNYGWTCA
BCL11A ENSG00000119866 C2H2 ZF Known motif – In vivo/Misc source [66] DDRRGGAASTGARAV
BCL11B ENSG00000127152 C2H2 ZF Known motif – High-throughput in vitro [67] GTGAACGBNDNNVCTACAC
BCL6 ENSG00000113916 C2H2 ZF Known motif – High-throughput in vitro [68] YGCTTTCKAGGAAH
BCL6B ENSG00000161940 C2H2 ZF Known motif – High-throughput in vitro [69] GCTTTCKAGGAAH
BHLHA15 ENSG00000180535 bHLH Known motif – High-throughput in vitro [70] VCATATGB
BHLHA9 ENSG00000205899 bHLH Likely sequence specific TF according to literature or domain structure – No motif [71]
BHLHE22 ENSG00000180828 bHLH Known motif – High-throughput in vitro [72] AVCATATGBT
BHLHE23 ENSG00000125533 bHLH Known motif – High-throughput in vitro [73] AVCATATGBY
BHLHE40 ENSG00000134107 bHLH Known motif – High-throughput in vitro [74] DKCACGTGM
BHLHE41 ENSG00000123095 bHLH Known motif – High-throughput in vitro [75] RKCACGTGAY
BNC1 ENSG00000169594 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [76] CCRCCWTCA
BNC2 ENSG00000173068 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [77] CCRCCWTCA
BORCS8-MEF2B ENSG00000064489 MADS box Known motif – from protein with 100% identical DBD – in vitro [78] CCDWWWHNRG
BPTF ENSG00000171634 Unknown Known motif – In vivo/Misc source [79] KKKNTTGTKKNV
BRF2 ENSG00000104221 Unknown Likely sequence specific TF according to literature or domain structure – No motif [80]
BSX ENSG00000188909 Homeodomain Known motif – High-throughput in vitro [81] TAATBR
C11orf95 ENSG00000188070 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [82]
CAMTA1 ENSG00000171735 CG-1 Likely sequence specific TF according to literature or domain structure – No motif [83]
CAMTA2 ENSG00000108509 CG-1 Likely sequence specific TF according to literature or domain structure – No motif [84]
CARF ENSG00000138380 Unknown Known motif – In vivo/Misc source [85] GCCTCGTTYTSR
CASZ1 ENSG00000130940 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [86]
CBX2 ENSG00000173894 AT hook Likely sequence specific TF according to literature or domain structure – No motif [87]
CC2D1A ENSG00000132024 Unknown Likely sequence specific TF according to literature or domain structure – No motif [88]
CCDC169-SOHLH2 ENSG00000250709 bHLH Known motif – from protein with 100% identical DBD – in vitro [89] BCACGTGC
CCDC17 ENSG00000159588 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [90]
CDC5L ENSG00000096401 Myb/SANT Known motif – In vivo/Misc source [91] VBGWKDTAAYRWAWB
CDX1 ENSG00000113722 Homeodomain Known motif – High-throughput in vitro [92] TTTATKRB
CDX2 ENSG00000165556 Homeodomain Known motif – High-throughput in vitro [93] DWWATKRB
CDX4 ENSG00000131264 Homeodomain Known motif – High-throughput in vitro [94] VKTTTATKRCH
CEBPA ENSG00000245848 bZIP Known motif – from protein with 100% identical DBD – in vitro [95] TTGCGHAA
CEBPB ENSG00000172216 bZIP Known motif – High-throughput in vitro [96] VTTRCGCAAY
CEBPD ENSG00000221869 bZIP Known motif – High-throughput in vitro [97] VTTRCGCAAY
CEBPE ENSG00000092067 bZIP Known motif – High-throughput in vitro [98] VTTRCGCAAY
CEBPG ENSG00000153879 bZIP Known motif – High-throughput in vitro [99] RTTRCGCAAY
CEBPZ ENSG00000115816 Unknown Known motif – In vivo/Misc source [100] DSTSATTGGCT
CENPA ENSG00000115163 Unknown Likely sequence specific TF according to literature or domain structure – No motif [101]
CENPB ENSG00000125817 CENPB Known motif – High-throughput in vitro [102] TWCGYNNNAHRCGGG
CENPBD1 ENSG00000177946 CENPB Known motif – High-throughput in vitro [103] WNYGWAD
CENPS ENSG00000175279 Unknown Likely sequence specific TF according to literature or domain structure – No motif [104]
CENPT ENSG00000102901 Unknown Likely sequence specific TF according to literature or domain structure – No motif [105]
CENPX ENSG00000169689 Unknown Likely sequence specific TF according to literature or domain structure – No motif [106]
CGGBP1 ENSG00000163320 Unknown Likely sequence specific TF according to literature or domain structure – No motif [107]
CHAMP1 ENSG00000198824 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [108]
CHCHD3 ENSG00000106554 Unknown Likely sequence specific TF according to literature or domain structure – No motif [109]
CIC ENSG00000079432 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [110] VTCAGCA
CLOCK ENSG00000134852 bHLH Known motif – High-throughput in vitro [111] DACACGTGYH
CPEB1 ENSG00000214575 Unknown Known motif – High-throughput in vitro [112] HTTTTATH
CPXCR1 ENSG00000147183 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [113]
CREB1 ENSG00000118260 bZIP Known motif – High-throughput in vitro [114] VTKACGTMA
CREB3 ENSG00000107175 bZIP Known motif – High-throughput in vitro [115] RTGACGTGKH
CREB3L1 ENSG00000157613 bZIP Known motif – High-throughput in vitro [116] TGCCACGTGGCR
CREB3L2 ENSG00000182158 bZIP Known motif – from protein with 100% identical DBD – in vitro [117] HCACGTGKM
CREB3L3 ENSG00000060566 bZIP Likely sequence specific TF according to literature or domain structure – No motif [118]
CREB3L4 ENSG00000143578 bZIP Known motif – High-throughput in vitro [119] VTGACGTGGM
CREB5 ENSG00000146592 bZIP Known motif – High-throughput in vitro [120] VTKACRTMAB
CREBL2 ENSG00000111269 bZIP Inferred motif from similar protein – High-throughput in vitro [121] ATKACGTMAY
CREBZF ENSG00000137504 bZIP Inferred motif from similar protein – High-throughput in vitro [122] WWACGTWD
CREM ENSG00000095794 bZIP Known motif – High-throughput in vitro [123] VVTBACGTVAB
CRX ENSG00000105392 Homeodomain Known motif – High-throughput in vitro [124] TAATCC
CSRNP1 ENSG00000144655 Unknown Likely sequence specific TF according to literature or domain structure – No motif [125]
CSRNP2 ENSG00000110925 Unknown Likely sequence specific TF according to literature or domain structure – No motif [126]
CSRNP3 ENSG00000178662 Unknown Likely sequence specific TF according to literature or domain structure – No motif [127]
CTCF ENSG00000102974 C2H2 ZF Known motif – High-throughput in vitro [128] CCDSBAGGKGGCGCB
CTCFL ENSG00000124092 C2H2 ZF Known motif – In vivo/Misc source [129] CCNSYAGGGGGCGCY
CUX1 ENSG00000257923 CUT; Homeodomain Known motif – High-throughput in vitro [130] ATYGATHA
CUX2 ENSG00000111249 CUT; Homeodomain Known motif – High-throughput in vitro [131] DDATYGATYA
CXXC1 ENSG00000154832 CxxC Known motif – High-throughput in vitro [132] BCG
CXXC4 ENSG00000168772 CxxC Likely sequence specific TF according to literature or domain structure – No motif [133]
CXXC5 ENSG00000171604 CxxC Known motif – High-throughput in vitro [134] DCK
DACH1 ENSG00000276644 Unknown Likely sequence specific TF according to literature or domain structure – No motif [135]
DACH2 ENSG00000126733 Unknown Likely sequence specific TF according to literature or domain structure – No motif [136]
DBP ENSG00000105516 bZIP Known motif – High-throughput in vitro [137] RTTAYRTAAB
DBX1 ENSG00000109851 Homeodomain Inferred motif from similar protein – High-throughput in vitro [138] WTTAATTA
DBX2 ENSG00000185610 Homeodomain Inferred motif from similar protein – High-throughput in vitro [139] AH
DDIT3 ENSG00000175197 bZIP Known motif – In vivo/Misc source [140] RVVKATTGCANNB
DEAF1 ENSG00000177030 SAND Inferred motif from similar protein – In vivo/Misc source [141] VCRBNYYCGKGDRYTTCCGDVDNNB
DLX1 ENSG00000144355 Homeodomain Known motif – High-throughput in vitro [142] TAATTR
DLX2 ENSG00000115844 Homeodomain Known motif – High-throughput in vitro [143] TAATTR
DLX3 ENSG00000064195 Homeodomain Known motif – High-throughput in vitro [144] TAATTR
DLX4 ENSG00000108813 Homeodomain Known motif – High-throughput in vitro [145] TAATTR
DLX5 ENSG00000105880 Homeodomain Known motif – High-throughput in vitro [146] TAATTR
DLX6 ENSG00000006377 Homeodomain Known motif – High-throughput in vitro [147] TAATTR
DMBX1 ENSG00000197587 Homeodomain Known motif – High-throughput in vitro [148] HTAATCCB
DMRT1 ENSG00000137090 DM Known motif – High-throughput in vitro [149] GHWACWH
DMRT2 ENSG00000173253 DM Known motif – High-throughput in vitro [150] DATAMATT
DMRT3 ENSG00000064218 DM Known motif – High-throughput in vitro [151] DWWTTGWTACAWT
DMRTA1 ENSG00000176399 DM Known motif – High-throughput in vitro [152] DDWTGHTACAW
DMRTA2 ENSG00000142700 DM Known motif – High-throughput in vitro [153] DHBGHWACADB
DMRTB1 ENSG00000143006 DM Likely sequence specific TF according to literature or domain structure – No motif [154]
DMRTC2 ENSG00000142025 DM Known motif – High-throughput in vitro [155] WWTTGHTACAW
DMTF1 ENSG00000135164 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [156]
DNMT1 ENSG00000130816 CxxC Known motif – High-throughput in vitro [157] CGG
DNTTIP1 ENSG00000101457 AT hook Likely sequence specific TF according to literature or domain structure – No motif [158]
DOT1L ENSG00000104885 AT hook Likely sequence specific TF according to literature or domain structure – No motif [159]
DPF1 ENSG00000011332 C2H2 ZF Known motif – High-throughput in vitro [160] KMTATAGGBG
DPF3 ENSG00000205683 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [161] KMTATAGGBG
DPRX ENSG00000204595 Homeodomain Known motif – High-throughput in vitro [162] RGMTAATCY
DR1 ENSG00000117505 Unknown Likely sequence specific TF according to literature or domain structure – No motif [163]
DRAP1 ENSG00000175550 Unknown Likely sequence specific TF according to literature or domain structure – No motif [164]
DRGX ENSG00000165606 Homeodomain Known motif – High-throughput in vitro [165] TAATYNAATTA
DUX1 DUX1_HUMAN Homeodomain Known motif – In vivo/Misc source [166] ATAATCTGATTAT
DUX3 DUX3_HUMAN Homeodomain Known motif – In vivo/Misc source [167] TTAATTAAATTAA
DUX4 ENSG00000260596 Homeodomain Known motif – In vivo/Misc source [168] TGATTRRRTTA
DUXA ENSG00000258873 Homeodomain Known motif – High-throughput in vitro [169] TGATTRVRTYD
DZIP1 ENSG00000134874 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [170]
E2F1 ENSG00000101412 E2F Known motif – High-throughput in vitro [171] WTTGGCGCCHWW
E2F2 ENSG00000007968 E2F Known motif – High-throughput in vitro [172] WDWWGGCGCCHWWH
E2F3 ENSG00000112242 E2F Known motif – High-throughput in vitro [173] TTTTGGCGCCMTTTTY
E2F4 ENSG00000205250 E2F Known motif – High-throughput in vitro [174] TTTGGCGCCAAA
E2F5 ENSG00000133740 E2F Known motif – In vivo/Misc source [175] TTTSGCGC
E2F6 ENSG00000169016 E2F Known motif – In vivo/Misc source [176] DGGMGGGARV
E2F7 ENSG00000165891 E2F Known motif – High-throughput in vitro [177] WTTTGGCGGGAAAH
E2F8 ENSG00000129173 E2F Known motif – High-throughput in vitro [178] TTTGGCGGGAAA
E4F1 ENSG00000167967 C2H2 ZF Known motif – In vivo/Misc source [179] RTGACGTARS
EBF1 ENSG00000164330 EBF1 Known motif – High-throughput in vitro [180] ANTCCCHWGGGAHH
EBF2 ENSG00000221818 EBF1 Known motif – In vivo/Misc source [181] VTGMAACCCCCWWTHVK
EBF3 ENSG00000108001 EBF1 Known motif – In vivo/Misc source [182] BTCCCYWGRGD
EBF4 ENSG00000088881 EBF1 Known motif – In vivo/Misc source [183] CGSATAACCMTTGTTATCAB
EEA1 ENSG00000102189 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [184]
EGR1 ENSG00000120738 C2H2 ZF Known motif – High-throughput in vitro [185] MCGCCCMCGCA
EGR2 ENSG00000122877 C2H2 ZF Known motif – High-throughput in vitro [186] MCGCCCACGCD
EGR3 ENSG00000179388 C2H2 ZF Known motif – High-throughput in vitro [187] HMCGCCCMCGCAH
EGR4 ENSG00000135625 C2H2 ZF Known motif – High-throughput in vitro [188] HMCGCCCACGCAH
EHF ENSG00000135373 Ets Known motif – High-throughput in vitro [189] ACCCGGAAGTD
ELF1 ENSG00000120690 Ets Known motif – High-throughput in vitro [190] WHSCGGAAGY
ELF2 ENSG00000109381 Ets Known motif – High-throughput in vitro [191] AMCCGGAAGTV
ELF3 ENSG00000163435 Ets; AT hook Known motif – High-throughput in vitro [192] WACCCGGAAGTR
ELF4 ENSG00000102034 Ets Known motif – High-throughput in vitro [193] ABSCGGAAGTR
ELF5 ENSG00000135374 Ets Known motif – High-throughput in vitro [194] WNVMGGAARY
ELK1 ENSG00000126767 Ets Known motif – High-throughput in vitro [195] RCCGGAAGT
ELK3 ENSG00000111145 Ets Known motif – High-throughput in vitro [196] RCCGGAAGT
ELK4 ENSG00000158711 Ets Known motif – High-throughput in vitro [197] ACCGGAARY
EMX1 ENSG00000135638 Homeodomain Known motif – High-throughput in vitro [198] BTAATTR
EMX2 ENSG00000170370 Homeodomain Known motif – High-throughput in vitro [199] BTAATTA
EN1 ENSG00000163064 Homeodomain Known motif – High-throughput in vitro [200] TAATTRVB
EN2 ENSG00000164778 Homeodomain Known motif – High-throughput in vitro [201] TAATTR
EOMES ENSG00000163508 T-box Known motif – High-throughput in vitro [202] WTCACACCTH
EPAS1 ENSG00000116016 bHLH Known motif – In vivo/Misc source [203] VDACGTGHH
ERF ENSG00000105722 Ets Known motif – High-throughput in vitro [204] ACCGGAARTV
ERG ENSG00000157554 Ets Known motif – High-throughput in vitro [205] ACCGGAARY
ESR1 ENSG00000091831 Nuclear receptor Known motif – High-throughput in vitro [206] AGGTCAYSRTGACCT
ESR2 ENSG00000140009 Nuclear receptor Known motif – from protein with 100% identical DBD – in vitro [207] RGGTCAH
ESRRA ENSG00000173153 Nuclear receptor Known motif – High-throughput in vitro [208] SAAGGTCA
ESRRB ENSG00000119715 Nuclear receptor Known motif – High-throughput in vitro [209] TCAAGGTCAWH
ESRRG ENSG00000196482 Nuclear receptor Known motif – High-throughput in vitro [210] SAAGGTCR
ESX1 ENSG00000123576 Homeodomain Known motif – High-throughput in vitro [211] TAATTR
ETS1 ENSG00000134954 Ets Known motif – High-throughput in vitro [212] RCCGGAWRYRYWTCCGSH
ETS2 ENSG00000157557 Ets Known motif – High-throughput in vitro [213] ACCGGAWGYRCWTCCGGT
ETV1 ENSG00000006468 Ets Known motif – High-throughput in vitro [214] RCCGGAWRY
ETV2 ENSG00000105672 Ets Known motif – High-throughput in vitro [215] DACCGGAARYD
ETV3 ENSG00000117036 Ets Known motif – High-throughput in vitro [216] AHCGGAWWTCCGNT
ETV3L ENSG00000253831 Ets Known motif – from protein with 100% identical DBD – in vitro [217] VGGAWR
ETV4 ENSG00000175832 Ets Known motif – High-throughput in vitro [218] RCCGGAWGY
ETV5 ENSG00000244405 Ets Known motif – High-throughput in vitro [219] DVCGGAWRY
ETV6 ENSG00000139083 Ets Known motif – High-throughput in vitro [220] SCGGAASCGGAAGYR
ETV7 ENSG00000010030 Ets Known motif – High-throughput in vitro [221] VVGGAAGYRCTTCCBB
EVX1 ENSG00000106038 Homeodomain Known motif – High-throughput in vitro [222] TAATBRB
EVX2 ENSG00000174279 Homeodomain Known motif – High-throughput in vitro [223] TAATBRB
FAM170A ENSG00000164334 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [224]
FAM200B ENSG00000237765 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [225]
FBXL19 ENSG00000099364 CxxC Likely sequence specific TF according to literature or domain structure – No motif [226]
FERD3L ENSG00000146618 bHLH Known motif – High-throughput in vitro [227] GYRMCAGCTGTBRC
FEV ENSG00000163497 Ets Known motif – High-throughput in vitro [228] ACCGGAART
FEZF1 ENSG00000128610 C2H2 ZF Known motif – High-throughput in vitro [229] AAAARRRCAV
FEZF2 ENSG00000153266 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [230] AAAWGAGCAATCA
FIGLA ENSG00000183733 bHLH Known motif – High-throughput in vitro [231] MCAGGTGKD
FIZ1 ENSG00000179943 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [232]
FLI1 ENSG00000151702 Ets Known motif – High-throughput in vitro [233] RCCGGAWRY
FLYWCH1 ENSG00000059122 FLYWCH Likely sequence specific TF according to literature or domain structure – No motif [234]
FOS ENSG00000170345 bZIP Known motif – High-throughput in vitro [235] BRTGACGTCAYV
FOSB ENSG00000125740 bZIP Known motif – High-throughput in vitro [236] RTGACGTCAY
FOSL1 ENSG00000175592 bZIP Known motif – High-throughput in vitro [237] DRTGAYRCR
FOSL2 ENSG00000075426 bZIP Known motif – High-throughput in vitro [238] TKANTCAYNRTGACGTCAY
FOXA1 ENSG00000129514 Forkhead Known motif – High-throughput in vitro [239] BVYTAWGTAAACAAW
FOXA2 ENSG00000125798 Forkhead Known motif – High-throughput in vitro [240] HNNGTMAATATTKRYNBD
FOXA3 ENSG00000170608 Forkhead Known motif – High-throughput in vitro [241] BVYTAWGTAAACAAA
FOXB1 ENSG00000171956 Forkhead Known motif – High-throughput in vitro [242] WRWGTMAATATTKACWYW
FOXB2 ENSG00000204612 Forkhead Inferred motif from similar protein – High-throughput in vitro [243] HWRWGYMAATATTKRCHYW
FOXC1 ENSG00000054598 Forkhead Known motif – High-throughput in vitro [244] WRWRTMAAYAW
FOXC2 ENSG00000176692 Forkhead Known motif – High-throughput in vitro [245] WAHRTMAAYAWW
FOXD1 ENSG00000251493 Forkhead Known motif – from protein with 100% identical DBD – in vitro [246] HWASAATAAYAWW
FOXD2 ENSG00000186564 Forkhead Known motif – High-throughput in vitro [247] RTAAAYA
FOXD3 ENSG00000187140 Forkhead Known motif – High-throughput in vitro [248] RTAAAYA
FOXD4 ENSG00000170122 Forkhead Inferred motif from similar protein – In vivo/Misc source [249] GTTAAAGCVAKTTTAA
FOXD4L1 ENSG00000184492 Forkhead Inferred motif from similar protein – In vivo/Misc source [250] GTTAAAGCVAKTTTAA
FOXD4L3 ENSG00000187559 Forkhead Inferred motif from similar protein – In vivo/Misc source [251] MGGTAAATCMAGGGWWT
FOXD4L4 ENSG00000184659 Forkhead Known motif – In vivo/Misc source [252] MGGTAAATCMAGGGWWT
FOXD4L5 ENSG00000204779 Forkhead Inferred motif from similar protein – In vivo/Misc source [253] MGGTAAATCMAGGGWWT
FOXD4L6 ENSG00000273514 Forkhead Inferred motif from similar protein – In vivo/Misc source [254] MGGTAAATCMAGGGWWT
FOXE1 ENSG00000178919 Forkhead Known motif – High-throughput in vitro [255] BVYTAWRYAAACAD
FOXE3 ENSG00000186790 Forkhead Inferred motif from similar protein – High-throughput in vitro [256] BVYTAWRYAAACAD
FOXF1 ENSG00000103241 Forkhead Known motif – In vivo/Misc source [257] YRHATAAACAHNB
FOXF2 ENSG00000137273 Forkhead Known motif – In vivo/Misc source [258] BNHNBRTAAACAHNV
FOXG1 ENSG00000176165 Forkhead Known motif – High-throughput in vitro [259] RTAAACAH
FOXH1 ENSG00000160973 Forkhead Known motif – In vivo/Misc source [260] BNSAATMCACA
FOXI1 ENSG00000168269 Forkhead Known motif – High-throughput in vitro [261] RTMAACA
FOXI2 ENSG00000186766 Forkhead Inferred motif from similar protein – High-throughput in vitro [262] RTMAACA
FOXI3 ENSG00000214336 Forkhead Inferred motif from similar protein – High-throughput in vitro [263] RTMAACA
FOXJ1 ENSG00000129654 Forkhead Known motif – from protein with 100% identical DBD – in vitro [264] HAAACAAA
FOXJ2 ENSG00000065970 Forkhead Known motif – High-throughput in vitro [265] GTAAACAWMAACA
FOXJ3 ENSG00000198815 Forkhead Known motif – High-throughput in vitro [266] RTAAACAW
FOXK1 ENSG00000164916 Forkhead Known motif – High-throughput in vitro [267] RWMMAYA
FOXK2 ENSG00000141568 Forkhead Inferred motif from similar protein – High-throughput in vitro [268] RWMAACAA
FOXL1 ENSG00000176678 Forkhead Known motif – High-throughput in vitro [269] RTAAACA
FOXL2 ENSG00000183770 Forkhead Known motif – High-throughput in vitro [270] VBGHMAACAH
FOXM1 ENSG00000111206 Forkhead Known motif – from protein with 100% identical DBD – in vitro [271] RWHR
FOXN1 ENSG00000109101 Forkhead Known motif – In vivo/Misc source [272] WVBSACGCB
FOXN2 ENSG00000170802 Forkhead Known motif – High-throughput in vitro [273] GCGTSNNNNNSACGC
FOXN3 ENSG00000053254 Forkhead Known motif – High-throughput in vitro [274] GTAAACAA
FOXN4 ENSG00000139445 Forkhead Known motif – In vivo/Misc source [275] WHNWRRNGACGCYATNHM
FOXO1 ENSG00000150907 Forkhead Known motif – High-throughput in vitro [276] RTAAACATGTTTAC
FOXO3 ENSG00000118689 Forkhead Known motif – High-throughput in vitro [277] GTAAACAW
FOXO4 ENSG00000184481 Forkhead Known motif – High-throughput in vitro [278] GTAAACA
FOXO6 ENSG00000204060 Forkhead Known motif – High-throughput in vitro [279] GTAAACATGTTTAC
FOXP1 ENSG00000114861 Forkhead Known motif – High-throughput in vitro [280] TGTTTRYNRTNNNNNNBNAYRVWMAACA
FOXP2 ENSG00000128573 Forkhead Known motif – High-throughput in vitro [281] RTAAAYAW
FOXP3 ENSG00000049768 Forkhead Known motif – High-throughput in vitro [282] RTAAACA
FOXP4 ENSG00000137166 Forkhead Inferred motif from similar protein – High-throughput in vitro [283] RTMAAYA
FOXQ1 ENSG00000164379 Forkhead Known motif – High-throughput in vitro [284] YWRHRTAAACWD
FOXR1 ENSG00000176302 Forkhead Known motif – High-throughput in vitro [285] CAADY
FOXR2 ENSG00000189299 Forkhead Known motif – High-throughput in vitro [286] RYRTAWACATAAAWRHH
FOXS1 ENSG00000179772 Forkhead Inferred motif from similar protein – High-throughput in vitro [287] HNNRHMAAYA
GABPA ENSG00000154727 Ets Known motif – High-throughput in vitro [288] RSCGGAWRY
GATA1 ENSG00000102145 GATA Known motif – High-throughput in vitro [289] GATWASMH
GATA2 ENSG00000179348 GATA Known motif – High-throughput in vitro [290] VHGATAHSV
GATA3 ENSG00000107485 GATA Known motif – High-throughput in vitro [291] HGATAAVV
GATA4 ENSG00000136574 GATA Known motif – High-throughput in vitro [292] HGATAAVV
GATA5 ENSG00000130700 GATA Known motif – High-throughput in vitro [293] HGATAASV
GATA6 ENSG00000141448 GATA Known motif – High-throughput in vitro [294] HGATAABVATCD
GATAD2A ENSG00000167491 GATA Likely sequence specific TF according to literature or domain structure – No motif [295]
GATAD2B ENSG00000143614 GATA Likely sequence specific TF according to literature or domain structure – No motif [296]
GBX1 ENSG00000164900 Homeodomain Known motif – High-throughput in vitro [297] BTAATTRSB
GBX2 ENSG00000168505 Homeodomain Known motif – High-throughput in vitro [298] TAATTR
GCM1 ENSG00000137270 GCM Known motif – High-throughput in vitro [299] BATGCGGGTRS
GCM2 ENSG00000124827 GCM Known motif – High-throughput in vitro [300] HRCCCGCAT
GFI1 ENSG00000162676 C2H2 ZF Known motif – High-throughput in vitro [301] BMAATCACDGCNHBBCACTM
GFI1B ENSG00000165702 C2H2 ZF Known motif – High-throughput in vitro [302] MAATCASDGCNNBBCACT
GLI1 ENSG00000111087 C2H2 ZF Known motif – In vivo/Misc source [303] SMCCHCCCA
GLI2 ENSG00000074047 C2H2 ZF Known motif – High-throughput in vitro [304] GMCCACMCANVNHB
GLI3 ENSG00000106571 C2H2 ZF Known motif – High-throughput in vitro [305] VGACCACCCACVNHG
GLI4 ENSG00000250571 C2H2 ZF Known motif – In vivo/Misc source [306] RRGCCTTGAATGCCANGNYMA
GLIS1 ENSG00000174332 C2H2 ZF Known motif – High-throughput in vitro [307] MGACCCCCCACGWHG
GLIS2 ENSG00000126603 C2H2 ZF Known motif – High-throughput in vitro [308] KACCCCCCRCRDHG
GLIS3 ENSG00000107249 C2H2 ZF Known motif – High-throughput in vitro [309] KACCCCCCACRAAG
GLMP ENSG00000198715 Unknown Likely sequence specific TF according to literature or domain structure – No motif [310]
GLYR1 ENSG00000140632 AT hook Likely sequence specific TF according to literature or domain structure – No motif [311]
GMEB1 ENSG00000162419 SAND Known motif – High-throughput in vitro [312] KTACGTAMNKTACGTMM
GMEB2 ENSG00000101216 SAND Known motif – High-throughput in vitro [313] YBACGYAM
GPBP1 ENSG00000062194 Unknown Likely sequence specific TF according to literature or domain structure – No motif [314]
GPBP1L1 ENSG00000159592 Unknown Likely sequence specific TF according to literature or domain structure – No motif [315]
GRHL1 ENSG00000134317 Grainyhead Known motif – High-throughput in vitro [316] DAACCGGTTH
GRHL2 ENSG00000083307 Grainyhead Known motif – In vivo/Misc source [317] RAACHDGHHHDDCHDGTTY
GRHL3 ENSG00000158055 Grainyhead Likely sequence specific TF according to literature or domain structure – No motif [318]
GSC ENSG00000133937 Homeodomain Known motif – High-throughput in vitro [319] HTAATCC
GSC2 ENSG00000063515 Homeodomain Known motif – High-throughput in vitro [320] HTAATCCBH
GSX1 ENSG00000169840 Homeodomain Known motif – High-throughput in vitro [321] TAATKR
GSX2 ENSG00000180613 Homeodomain Known motif – High-throughput in vitro [322] TAATKR
GTF2B ENSG00000137947 Unknown Known motif – In vivo/Misc source [323] STYWYAKASTS
GTF2I ENSG00000263001 GTF2I-like Known motif – In vivo/Misc source [324] VAGVDVKTSH
GTF2IRD1 ENSG00000006704 GTF2I-like Known motif – In vivo/Misc source [325] TRTCGCWG
GTF2IRD2 ENSG00000196275 GTF2I-like Likely sequence specific TF according to literature or domain structure – No motif [326]
GTF2IRD2B ENSG00000174428 GTF2I-like Likely sequence specific TF according to literature or domain structure – No motif [327]
GTF3A ENSG00000122034 C2H2 ZF Known motif – High-throughput in vitro [328] GGATGGGAG
GZF1 ENSG00000125812 C2H2 ZF Known motif – In vivo/Misc source [329] TATAKAVGCGCA
HAND1 ENSG00000113196 bHLH Known motif – In vivo/Misc source [330] DBRTCTGGHWDH
HAND2 ENSG00000164107 bHLH Known motif – High-throughput in vitro [331] HVCAGGTGTK
HBP1 ENSG00000105856 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [332] DD
HDX ENSG00000165259 Homeodomain Known motif – High-throughput in vitro [333] H
HELT ENSG00000187821 bHLH Inferred motif from similar protein – High-throughput in vitro [334] BBCACGTGY
HES1 ENSG00000114315 bHLH Known motif – High-throughput in vitro [335] KDCRCGTGBB
HES2 ENSG00000069812 bHLH Known motif – High-throughput in vitro [336] VRCACGTGCC
HES3 ENSG00000173673 bHLH Inferred motif from similar protein – High-throughput in vitro [337] KDCRCGTGBB
HES4 ENSG00000188290 bHLH Inferred motif from similar protein – High-throughput in vitro [338] KDCRCGTGBB
HES5 ENSG00000197921 bHLH Known motif – High-throughput in vitro [339] HGGCACGTGYCR
HES6 ENSG00000144485 bHLH Known motif – High-throughput in vitro [340] DACACGTGCC
HES7 ENSG00000179111 bHLH Known motif – High-throughput in vitro [341] YGGCACGTGCCR
HESX1 ENSG00000163666 Homeodomain Known motif – High-throughput in vitro [342] HTAATTRVH
HEY1 ENSG00000164683 bHLH Known motif – High-throughput in vitro [343] BBCRCGYGY
HEY2 ENSG00000135547 bHLH Known motif – High-throughput in vitro [344] BCACGTGB
HEYL ENSG00000163909 bHLH Inferred motif from similar protein – High-throughput in vitro [345] BCACGTGB
HHEX ENSG00000152804 Homeodomain Inferred motif from similar protein – High-throughput in vitro [346] ATND
HIC1 ENSG00000177374 C2H2 ZF Known motif – High-throughput in vitro [347] RTGCCMMC
HIC2 ENSG00000169635 C2H2 ZF Known motif – High-throughput in vitro [348] BKGGCAY
HIF1A ENSG00000100644 bHLH Known motif – In vivo/Misc source [349] VVNGCACGTMBNS
HIF3A ENSG00000124440 bHLH Inferred motif from similar protein – In vivo/Misc source [350] RWAWWTMATAWCST
HINFP ENSG00000172273 C2H2 ZF Known motif – High-throughput in vitro [351] GCGGACGYTRSRRCGTCCGC
HIVEP1 ENSG00000095951 C2H2 ZF Known motif – In vivo/Misc source [352] KGRRRARTCCCB
HIVEP2 ENSG00000010818 C2H2 ZF Known motif – In vivo/Misc source [353] KBYDNGGHAABNSS
HIVEP3 ENSG00000127124 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [354] KBYDNGGHAABNSS
HKR1 ENSG00000181666 C2H2 ZF Known motif – High-throughput in vitro [355] VBKVRVNRDGGAGGRBVNVR
HLF ENSG00000108924 bZIP Known motif – High-throughput in vitro [356] VTTAYRTAAY
HLX ENSG00000136630 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [357] AWND
HMBOX1 ENSG00000147421 Homeodomain Known motif – High-throughput in vitro [358] VYTAGTTAMV
HMG20A ENSG00000140382 HMG/Sox Likely sequence specific TF according to literature or domain structure – No motif [359]
HMG20B ENSG00000064961 HMG/Sox Inferred motif from similar protein – High-throughput in vitro [360] WDWATAAT
HMGA1 ENSG00000137309 AT hook Known motif – In vivo/Misc source [361] WATTWW
HMGA2 ENSG00000149948 AT hook Known motif – In vivo/Misc source [362] ATATTSSSSDWWAWT
HMGN3 ENSG00000118418 HMG/Sox Likely sequence specific TF according to literature or domain structure – No motif [363]
HMX1 ENSG00000215612 Homeodomain Known motif – High-throughput in vitro [364] TTAAKTGNY
HMX2 ENSG00000188816 Homeodomain Known motif – High-throughput in vitro [365] TTAAKTG
HMX3 ENSG00000188620 Homeodomain Known motif – High-throughput in vitro [366] TAAKTG
HNF1A ENSG00000135100 Homeodomain Known motif – High-throughput in vitro [367] GTTAATNATTAAY
HNF1B ENSG00000275410 Homeodomain Known motif – High-throughput in vitro [368] GTTAATNATTAAY
HNF4A ENSG00000101076 Nuclear receptor Known motif – High-throughput in vitro [369] VRGGTCAAAGTCCA
HNF4G ENSG00000164749 Nuclear receptor Known motif – In vivo/Misc source [370] GDNCAAAGKYCA
HOMEZ ENSG00000215271 Homeodomain Known motif – High-throughput in vitro [371] WWWAATCGTTTW
HOXA1 ENSG00000105991 Homeodomain Known motif – High-throughput in vitro [372] TAATTR
HOXA10 ENSG00000253293 Homeodomain Known motif – High-throughput in vitro [373] TTWAYGAY
HOXA11 ENSG00000005073 Homeodomain Known motif – High-throughput in vitro [374] DWTTTACGACB
HOXA13 ENSG00000106031 Homeodomain Known motif – High-throughput in vitro [375] DTTTTATKRS
HOXA2 ENSG00000105996 Homeodomain Known motif – High-throughput in vitro [376] BTAATKR
HOXA3 ENSG00000105997 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [377] TAATKR
HOXA4 ENSG00000197576 Homeodomain Known motif – High-throughput in vitro [378] TAATKRY
HOXA5 ENSG00000106004 Homeodomain Known motif – High-throughput in vitro [379] STAATKRS
HOXA6 ENSG00000106006 Homeodomain Known motif – High-throughput in vitro [380] TAATKRV
HOXA7 ENSG00000122592 Homeodomain Known motif – High-throughput in vitro [381] TAATKRV
HOXA9 ENSG00000078399 Homeodomain Known motif – High-throughput in vitro [382] DTTWAYGAY
HOXB1 ENSG00000120094 Homeodomain Known motif – High-throughput in vitro [383] STAATTA
HOXB13 ENSG00000159184 Homeodomain Known motif – High-throughput in vitro [384] TTWAYDD
HOXB2 ENSG00000173917 Homeodomain Known motif – High-throughput in vitro [385] TAATKR
HOXB3 ENSG00000120093 Homeodomain Known motif – High-throughput in vitro [386] BTAATKR
HOXB4 ENSG00000182742 Homeodomain Known motif – High-throughput in vitro [387] YTAATKAY
HOXB5 ENSG00000120075 Homeodomain Known motif – High-throughput in vitro [388] TAATKRV
HOXB6 ENSG00000108511 Homeodomain Known motif – High-throughput in vitro [389] TAATKRY
HOXB7 ENSG00000260027 Homeodomain Known motif – High-throughput in vitro [390] BTAATKRV
HOXB8 ENSG00000120068 Homeodomain Known motif – High-throughput in vitro [391] TAATKRM
HOXB9 ENSG00000170689 Homeodomain Known motif – High-throughput in vitro [392] WTTTAYGAY
HOXC10 ENSG00000180818 Homeodomain Known motif – High-throughput in vitro [393] WTTWAYGAB
HOXC11 ENSG00000123388 Homeodomain Known motif – High-throughput in vitro [394] WTTWAYGAYH
HOXC12 ENSG00000123407 Homeodomain Known motif – High-throughput in vitro [395] DTTTTACGAYY
HOXC13 ENSG00000123364 Homeodomain Known motif – High-throughput in vitro [396] CTCGTAAAAH
HOXC4 ENSG00000198353 Homeodomain Known motif – High-throughput in vitro [397] TAATKR
HOXC5 ENSG00000172789 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [398] WRATND
HOXC6 ENSG00000197757 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [399] TTAATTAB
HOXC8 ENSG00000037965 Homeodomain Known motif – High-throughput in vitro [400] YAATTR
HOXC9 ENSG00000180806 Homeodomain Known motif – High-throughput in vitro [401] TTTTACGAC
HOXD1 ENSG00000128645 Homeodomain Known motif – High-throughput in vitro [402] BTAATTAV
HOXD10 ENSG00000128710 Homeodomain Known motif – High-throughput in vitro [403] DTTTTACGACY
HOXD11 ENSG00000128713 Homeodomain Known motif – High-throughput in vitro [404] DWTTTACGAY
HOXD12 ENSG00000170178 Homeodomain Known motif – High-throughput in vitro [405] DTTTACGAY
HOXD13 ENSG00000128714 Homeodomain Known motif – High-throughput in vitro [406] BCTCGTAAAAH
HOXD3 ENSG00000128652 Homeodomain Known motif – High-throughput in vitro [407] CTAATTAS
HOXD4 ENSG00000170166 Homeodomain Known motif – High-throughput in vitro [408] TMATKRV
HOXD8 ENSG00000175879 Homeodomain Known motif – High-throughput in vitro [409] HWMATTWDB
HOXD9 ENSG00000128709 Homeodomain Known motif – High-throughput in vitro [410] TTTTATKRC
HSF1 ENSG00000185122 HSF Known motif – High-throughput in vitro [411] VGAABVTTCBVGAW
HSF2 ENSG00000025156 HSF Known motif – High-throughput in vitro [412] VGAANNTTCBVGAA
HSF4 ENSG00000102878 HSF Known motif – High-throughput in vitro [413] GAANNTTCBVGAA
HSF5 ENSG00000176160 HSF Known motif – High-throughput in vitro [414] RCGTTCTAGAAYGY
HSFX1 ENSG00000171116 HSF Likely sequence specific TF according to literature or domain structure – No motif [415]
HSFX2 ENSG00000268738 HSF Likely sequence specific TF according to literature or domain structure – No motif [416]
HSFY1 ENSG00000172468 HSF Known motif – High-throughput in vitro [417] DTVGAAYGWTTCGAAYGB
HSFY2 ENSG00000169953 HSF Known motif – High-throughput in vitro [418] DTCGAAHSNWTCGAW
IKZF1 ENSG00000185811 C2H2 ZF Known motif – In vivo/Misc source [419] BTGGGARD
IKZF2 ENSG00000030419 C2H2 ZF Known motif – In vivo/Misc source [420] HDWHGGGADD
IKZF3 ENSG00000161405 C2H2 ZF Known motif – High-throughput in vitro [421] VSNNGGGAA
IKZF4 ENSG00000123411 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [422] HDWHGGGADD
IKZF5 ENSG00000095574 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [423] MYYATGCAGRGT
INSM1 ENSG00000173404 C2H2 ZF Known motif – In vivo/Misc source [424] YRMCCCCWKRCA
INSM2 ENSG00000168348 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [425]
IRF1 ENSG00000125347 IRF Known motif – In vivo/Misc source [426] GAAASTGAAASY
IRF2 ENSG00000168310 IRF Known motif – High-throughput in vitro [427] GAAAVYGAAAS
IRF3 ENSG00000126456 IRF Known motif – High-throughput in vitro [428] HSGAAAVBGAAACYGAAAC
IRF4 ENSG00000137265 IRF Known motif – High-throughput in vitro [429] HCGAAACCGAAACYW
IRF5 ENSG00000128604 IRF Known motif – High-throughput in vitro [430] CGAAACCGAWACH
IRF6 ENSG00000117595 IRF Known motif – High-throughput in vitro [431] RGTWTCRNNNNNNCGAWACY
IRF7 ENSG00000185507 IRF Known motif – High-throughput in vitro [432] CGAAAVYGAAANY
IRF8 ENSG00000140968 IRF Known motif – High-throughput in vitro [433] CGAAACYGAAACY
IRF9 ENSG00000213928 IRF Known motif – High-throughput in vitro [434] AWCGAAACCGAAACY
IRX1 ENSG00000170549 Homeodomain Known motif – High-throughput in vitro [435] DDCRHNNNNNNNNDYGHH
IRX2 ENSG00000170561 Homeodomain Known motif – High-throughput in vitro [436] DTGTYRTGTH
IRX3 ENSG00000177508 Homeodomain Known motif – High-throughput in vitro [437] DACAHGNWWWWNCDTGTH
IRX4 ENSG00000113430 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [438] DAMAH
IRX5 ENSG00000176842 Homeodomain Known motif – High-throughput in vitro [439] DTGTYRTGTH
IRX6 ENSG00000159387 Homeodomain Inferred motif from similar protein – High-throughput in vitro [440] DAMAH
ISL1 ENSG00000016082 Homeodomain Known motif – High-throughput in vitro [441] BTAAKTGS
ISL2 ENSG00000159556 Homeodomain Known motif – High-throughput in vitro [442] YTAAKTGB
ISX ENSG00000175329 Homeodomain Known motif – High-throughput in vitro [443] CYAATTAV
JAZF1 ENSG00000153814 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [444]
JDP2 ENSG00000140044 bZIP Known motif – High-throughput in vitro [445] RTKACRTMAY
JRK ENSG00000234616 CENPB Likely sequence specific TF according to literature or domain structure – No motif [446]
JRKL ENSG00000183340 CENPB Inferred motif from similar protein – High-throughput in vitro [447] RCGGWWR
JUN ENSG00000177606 bZIP Known motif – High-throughput in vitro [448] DATGACGTMAHNV
JUNB ENSG00000171223 bZIP Known motif – High-throughput in vitro [449] RTKACGTMAY
JUND ENSG00000130522 bZIP Known motif – High-throughput in vitro [450] VTGACGTMA
KAT7 ENSG00000136504 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [451]
KCMF1 ENSG00000176407 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [452]
KCNIP3 ENSG00000115041 Unknown Likely sequence specific TF according to literature or domain structure – No motif [453]
KDM2A ENSG00000173120 CxxC Likely sequence specific TF according to literature or domain structure – No motif [454]
KDM2B ENSG00000089094 CxxC Known motif – High-throughput in vitro [455] CG
KDM5B ENSG00000117139 ARID/BRIGHT Likely sequence specific TF according to literature or domain structure – No motif [456]
KIN ENSG00000151657 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [457]
KLF1 ENSG00000105610 C2H2 ZF Known motif – High-throughput in vitro [458] CMCGCCCM
KLF10 ENSG00000155090 C2H2 ZF Known motif – High-throughput in vitro [459] RMCACRCCCMYVHCACRCCCMC
KLF11 ENSG00000172059 C2H2 ZF Known motif – High-throughput in vitro [460] VMCMCRCCCMYNMCACGCCCMC
KLF12 ENSG00000118922 C2H2 ZF Known motif – High-throughput in vitro [461] DRCCACGCCCH
KLF13 ENSG00000169926 C2H2 ZF Known motif – High-throughput in vitro [462] RCCACRCCCMC
KLF14 ENSG00000266265 C2H2 ZF Known motif – High-throughput in vitro [463] DRHCACGCCCMYYH
KLF15 ENSG00000163884 C2H2 ZF Known motif – High-throughput in vitro [464] VHCMCVCCCMY
KLF16 ENSG00000129911 C2H2 ZF Known motif – High-throughput in vitro [465] VMCMCDCCCMC
KLF17 ENSG00000171872 C2H2 ZF Known motif – High-throughput in vitro [466] MMCCACVCWCCCMTY
KLF2 ENSG00000127528 C2H2 ZF Known motif – High-throughput in vitro [467] VCCMCRCCCH
KLF3 ENSG00000109787 C2H2 ZF Known motif – High-throughput in vitro [468] RRCCRCGCCCH
KLF4 ENSG00000136826 C2H2 ZF Known motif – High-throughput in vitro [469] VCCACRCCCH
KLF5 ENSG00000102554 C2H2 ZF Known motif – High-throughput in vitro [470] MCACRCCCH
KLF6 ENSG00000067082 C2H2 ZF Known motif – High-throughput in vitro [471] VMCACRCCCH
KLF7 ENSG00000118263 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [472] HHMCRCCCH
KLF8 ENSG00000102349 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [473] MCRCCY
KLF9 ENSG00000119138 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [474] TAACGG
KMT2A ENSG00000118058 CxxC; AT hook Known motif – High-throughput in vitro [475] HNCGNB
KMT2B ENSG00000272333 CxxC; AT hook Likely sequence specific TF according to literature or domain structure – No motif [476]
L3MBTL1 ENSG00000185513 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [477]
L3MBTL3 ENSG00000198945 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [478]
L3MBTL4 ENSG00000154655 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [479]
LBX1 ENSG00000138136 Homeodomain Known motif – High-throughput in vitro [480] TAAYTRG
LBX2 ENSG00000179528 Homeodomain Known motif – High-throughput in vitro [481] TAATTRV
LCOR ENSG00000196233 Pipsqueak Known motif – from protein with 100% identical DBD – in vitro [482] YNAAW
LCORL ENSG00000178177 Pipsqueak Known motif – High-throughput in vitro [483] HYNAAWH
LEF1 ENSG00000138795 HMG/Sox Known motif – High-throughput in vitro [484] SATCAAAS
LEUTX ENSG00000213921 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [485]
LHX1 ENSG00000273706 Homeodomain Known motif – High-throughput in vitro [486] TRATBR
LHX2 ENSG00000106689 Homeodomain Known motif – High-throughput in vitro [487] HHDTTR
LHX3 ENSG00000107187 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [488] YAATHW
LHX4 ENSG00000121454 Homeodomain Known motif – High-throughput in vitro [489] BYRATTRV
LHX5 ENSG00000089116 Homeodomain Known motif – High-throughput in vitro [490] TAATTRS
LHX6 ENSG00000106852 Homeodomain Known motif – High-throughput in vitro [491] TRATTR
LHX8 ENSG00000162624 Homeodomain Known motif – High-throughput in vitro [492] STAATTA
LHX9 ENSG00000143355 Homeodomain Known motif – High-throughput in vitro [493] TAATTRG
LIN28A ENSG00000131914 CSD Inferred motif from similar protein – High-throughput in vitro [494] CGCHGYYHYWYCGCG
LIN28B ENSG00000187772 CSD Known motif – High-throughput in vitro [495] CGCHGYYHYWYCGCG
LIN54 ENSG00000189308 TCR/CxC Inferred motif from similar protein – High-throughput in vitro [496] RTTYAAAH
LMX1A ENSG00000162761 Homeodomain Known motif – High-throughput in vitro [497] BTAATTA
LMX1B ENSG00000136944 Homeodomain Known motif – High-throughput in vitro [498] TWATTR
LTF ENSG00000012223 Unknown Known motif – In vivo/Misc source [499] GKVACTKB
LYL1 ENSG00000104903 bHLH Inferred motif from similar protein – In vivo/Misc source [500] RNCAGVTGGH
MAF ENSG00000178573 bZIP Known motif – High-throughput in vitro [501] TGCTGACDHDRCR
MAFA ENSG00000182759 bZIP Known motif – High-throughput in vitro [502] WWWNTGCTGACD
MAFB ENSG00000204103 bZIP Known motif – from protein with 100% identical DBD – in vitro [503] TGCTGAC
MAFF ENSG00000185022 bZIP Known motif – High-throughput in vitro [504] YGCTGASTCAGCR
MAFG ENSG00000197063 bZIP Known motif – High-throughput in vitro [505] YGCTGABNDNGCR
MAFK ENSG00000198517 bZIP Known motif – High-throughput in vitro [506] DNNYGCTKAVTCAGCRNNH
MAX ENSG00000125952 bHLH Known motif – High-throughput in vitro [507] CACGTG
MAZ ENSG00000103495 C2H2 ZF Known motif – High-throughput in vitro [508] GGGMGGGGS
MBD1 ENSG00000141644 MBD; CxxC ZF Likely sequence specific TF according to literature or domain structure – No motif [509]
MBD2 ENSG00000134046 MBD Known motif – In vivo/Misc source [510] VSGKCCGGMKR
MBD3 ENSG00000071655 MBD Likely sequence specific TF according to literature or domain structure – No motif [511]
MBD4 ENSG00000129071 MBD Likely sequence specific TF according to literature or domain structure – No motif [512]
MBD6 ENSG00000166987 MBD Likely sequence specific TF according to literature or domain structure – No motif [513]
MBNL2 ENSG00000139793 CCCH ZF Likely sequence specific TF according to literature or domain structure – High-throughput in vitro [514] YGCYTYGCYTH
MECOM ENSG00000085276 C2H2 ZF Known motif – In vivo/Misc source [515] WGAYAAGATAANAND
MECP2 ENSG00000169057 MBD; AT hook Known motif – from protein with 100% identical DBD – in vitro [516] DTD
MEF2A ENSG00000068305 MADS box Known motif – High-throughput in vitro [517] KCTAWAAATAGM
MEF2B ENSG00000213999 MADS box Known motif – High-throughput in vitro [518] TGTTACCATAWHBGG
MEF2C ENSG00000081189 MADS box Known motif – High-throughput in vitro [519] TWCTAWAAATAG
MEF2D ENSG00000116604 MADS box Known motif – High-throughput in vitro [520] DCTAWAAATAGM
MEIS1 ENSG00000143995 Homeodomain Known motif – High-throughput in vitro [521] TGACA
MEIS2 ENSG00000134138 Homeodomain Known motif – High-throughput in vitro [522] TGACASSTGTC
MEIS3 ENSG00000105419 Homeodomain Known motif – High-throughput in vitro [523] TGACAGSTGTCA
MEOX1 ENSG00000005102 Homeodomain Known motif – High-throughput in vitro [524] STAATTA
MEOX2 ENSG00000106511 Homeodomain Known motif – High-throughput in vitro [525] STMATYA
MESP1 ENSG00000166823 bHLH Known motif – High-throughput in vitro [526] HVCACCTGB
MESP2 ENSG00000188095 bHLH Known motif – High-throughput in vitro [527] AMCATATGKYR
MGA ENSG00000174197 T-box Known motif – High-throughput in vitro [528] AGGTGTKAHDTMACACCT
MITF ENSG00000187098 bHLH Known motif – from protein with 100% identical DBD – in vitro [529] RTCACGHG
MIXL1 ENSG00000185155 Homeodomain Known motif – High-throughput in vitro [530] TAATTR
MKX ENSG00000150051 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [531]
MLX ENSG00000108788 bHLH Known motif – High-throughput in vitro [532] VCACGTGVY
MLXIP ENSG00000175727 bHLH Inferred motif from similar protein – High-throughput in vitro [533] HCACGTGV
MLXIPL ENSG00000009950 bHLH Known motif – High-throughput in vitro [534] DDCACGTGNH
MNT ENSG00000070444 bHLH Known motif – High-throughput in vitro [535] DNCACGTGB
MNX1 ENSG00000130675 Homeodomain Known motif – High-throughput in vitro [536] HTAATTRNH
MSANTD1 ENSG00000188981 MADF Likely sequence specific TF according to literature or domain structure – No motif [537]
MSANTD3 ENSG00000066697 MADF Known motif – High-throughput in vitro [538] SBNCACTCAM
MSANTD4 ENSG00000170903 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [539]
MSC ENSG00000178860 bHLH Known motif – High-throughput in vitro [540] RMCAGCTGBYV
MSGN1 ENSG00000151379 bHLH Known motif – High-throughput in vitro [541] VMCAWWTGGY
MSX1 ENSG00000163132 Homeodomain Known motif – High-throughput in vitro [542] TAATTR
MSX2 ENSG00000120149 Homeodomain Known motif – High-throughput in vitro [543] TAATTGB
MTERF1 ENSG00000127989 mTERF Known motif – In vivo/Misc source [544] TGGTAVWRKTYGGT
MTERF2 ENSG00000120832 mTERF Likely sequence specific TF according to literature or domain structure – No motif [545]
MTERF3 ENSG00000156469 mTERF Likely sequence specific TF according to literature or domain structure – No motif [546]
MTERF4 ENSG00000122085 mTERF Likely sequence specific TF according to literature or domain structure – No motif [547]
MTF1 ENSG00000188786 C2H2 ZF Known motif – High-throughput in vitro [548] TTTGCACACGGCAC
MTF2 ENSG00000143033 Unknown Known motif – High-throughput in vitro [549]
MXD1 ENSG00000059728 bHLH Inferred motif from similar protein – In vivo/Misc source [550] CACGTGAY
MXD3 ENSG00000213347 bHLH Inferred motif from similar protein – In vivo/Misc source [551] CACGTGAY
MXD4 ENSG00000123933 bHLH Inferred motif from similar protein – In vivo/Misc source [552] CACGTGAY
MXI1 ENSG00000119950 bHLH Known motif – In vivo/Misc source [553] CCACGTGG
MYB ENSG00000118513 Myb/SANT Known motif – In vivo/Misc source [554] BAACKGNH
MYBL1 ENSG00000185697 Myb/SANT Known motif – High-throughput in vitro [555] HRACCGTTW
MYBL2 ENSG00000101057 Myb/SANT Known motif – High-throughput in vitro [556] WAACGGTY
MYC ENSG00000136997 bHLH Known motif – In vivo/Misc source [557] RCCACGTGSB
MYCL ENSG00000116990 bHLH Inferred motif from similar protein – In vivo/Misc source [558] RCCACGTG
MYCN ENSG00000134323 bHLH Known motif – High-throughput in vitro [559] VCACGTG
MYF5 ENSG00000111049 bHLH Known motif – In vivo/Misc source [560] VCWSCASSTGYCW
MYF6 ENSG00000111046 bHLH Known motif – High-throughput in vitro [561] RACASSTGWYV
MYNN ENSG00000085274 C2H2 ZF Known motif – High-throughput in vitro [562] AAAWTAARAGYC
MYOD1 ENSG00000129152 bHLH Known motif – High-throughput in vitro [563] YGHCAGSTGKYV
MYOG ENSG00000122180 bHLH Known motif – High-throughput in vitro [564] RACARCTGWCR
MYPOP ENSG00000176182 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [565]
MYRF ENSG00000124920 Ndt80/PhoG Known motif – High-throughput in vitro [566] TGGTACCA
MYRFL ENSG00000166268 Ndt80/PhoG Likely sequence specific TF according to literature or domain structure – No motif [567]
MYSM1 ENSG00000162601 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [568]
MYT1 ENSG00000196132 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [569]
MYT1L ENSG00000186487 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [570] VAAGTTT
MZF1 ENSG00000099326 C2H2 ZF Known motif – In vivo/Misc source [571] DRDGGGGAD
NACC2 ENSG00000148411 Unknown Likely sequence specific TF according to literature or domain structure – No motif [572]
NAIF1 ENSG00000171169 MADF Inferred motif from similar protein – High-throughput in vitro [573] TACGYH
NANOG ENSG00000111704 Homeodomain Known motif – High-throughput in vitro [574] YRABBVB
NANOGNB ENSG00000205857 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [575]
NANOGP8 ENSG00000255192 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [576] YRABBVB
NCOA1 ENSG00000084676 bHLH Likely sequence specific TF according to literature or domain structure – No motif [577]
NCOA2 ENSG00000140396 bHLH Likely sequence specific TF according to literature or domain structure – No motif [578]
NCOA3 ENSG00000124151 bHLH Likely sequence specific TF according to literature or domain structure – No motif [579]
NEUROD1 ENSG00000162992 bHLH Known motif – High-throughput in vitro [580] AAWTANNNBRMCATATGKY
NEUROD2 ENSG00000171532 bHLH Known motif – High-throughput in vitro [581] RMCATATGBY
NEUROD4 ENSG00000123307 bHLH Inferred motif from similar protein – High-throughput in vitro [582] AAWTANNNBRMCATATGKY
NEUROD6 ENSG00000164600 bHLH Inferred motif from similar protein – High-throughput in vitro [583] AAWTANNNBRMCATATGKY
NEUROG1 ENSG00000181965 bHLH Known motif – High-throughput in vitro [584] RVCATATGBY
NEUROG2 ENSG00000178403 bHLH Known motif – High-throughput in vitro [585] RVCATATGBY
NEUROG3 ENSG00000122859 bHLH Inferred motif from similar protein – High-throughput in vitro [586] RVCATATGBY
NFAT5 ENSG00000102908 Rel Known motif – High-throughput in vitro [587] RTGGAAAWKTACH
NFATC1 ENSG00000131196 Rel Known motif – High-throughput in vitro [588] RTGGAAAHW
NFATC2 ENSG00000101096 Rel Known motif – High-throughput in vitro [589] DYGGAAANW
NFATC3 ENSG00000072736 Rel Known motif – High-throughput in vitro [590] YGGAAANH
NFATC4 ENSG00000100968 Rel Known motif – High-throughput in vitro [591] YRBWWW
NFE2 ENSG00000123405 bZIP Known motif – High-throughput in vitro [592] VATGACTCATB
NFE2L1 ENSG00000082641 bZIP Known motif – In vivo/Misc source [593] ATGAYD
NFE2L2 ENSG00000116044 bZIP Known motif – In vivo/Misc source [594] VVTGACTMAGCA
NFE2L3 ENSG00000050344 bZIP Known motif – In vivo/Misc source [595] TATTWSCAAGGA
NFE4 ENSG00000230257 Unknown Known motif – In vivo/Misc source [596] VHCCCKMKCCWS
NFIA ENSG00000162599 SMAD Known motif – High-throughput in vitro [597] YTGGCANNNTGCCAA
NFIB ENSG00000147862 SMAD Known motif – High-throughput in vitro [598] TTGGCANNNTGCCAR
NFIC ENSG00000141905 SMAD Known motif – High-throughput in vitro [599] YTGGCANNNNGCCAA
NFIL3 ENSG00000165030 bZIP Known motif – High-throughput in vitro [600] VTTACRTAAY
NFIX ENSG00000008441 SMAD Known motif – High-throughput in vitro [601] TTGGCANNNTGCCAR
NFKB1 ENSG00000109320 Rel Known motif – High-throughput in vitro [602] AGGGGAWTCCCCK
NFKB2 ENSG00000077150 Rel Known motif – High-throughput in vitro [603] VGGGGAWTCCCC
NFX1 ENSG00000086102 NFX Likely sequence specific TF according to literature or domain structure – No motif [604]
NFXL1 ENSG00000170448 NFX Likely sequence specific TF according to literature or domain structure – No motif [605]
NFYA ENSG00000001167 CBF/NF-Y Known motif – In vivo/Misc source [606] HBSYSATTGGYYV
NFYB ENSG00000120837 Unknown Known motif – In vivo/Misc source [607] CTSATTGGYYVVNNB
NFYC ENSG00000066136 Unknown Known motif – In vivo/Misc source [608] BSTSATTGGYYR
NHLH1 ENSG00000171786 bHLH Known motif – High-throughput in vitro [609] DKGRCGCAGCTGMKNCH
NHLH2 ENSG00000177551 bHLH Known motif – High-throughput in vitro [610] DDGNMGCAGCTGCGYCMH
NKRF ENSG00000186416 Unknown Likely sequence specific TF according to literature or domain structure – No motif [611]
NKX1-1 ENSG00000235608 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [612] TAATND
NKX1-2 ENSG00000229544 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [613] TAAWND
NKX2-1 ENSG00000136352 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [614] RAGDR
NKX2-2 ENSG00000125820 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [615] RAGDR
NKX2-3 ENSG00000119919 Homeodomain Known motif – High-throughput in vitro [616] VCACTTV
NKX2-4 ENSG00000125816 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [617] RAGDR
NKX2-5 ENSG00000183072 Homeodomain Known motif – High-throughput in vitro [618] VCACTTRDV
NKX2-6 ENSG00000180053 Homeodomain Inferred motif from similar protein – High-throughput in vitro [619] HYAAGTRB
NKX2-8 ENSG00000136327 Homeodomain Known motif – High-throughput in vitro [620] BTSRAGTGB
NKX3-1 ENSG00000167034 Homeodomain Known motif – High-throughput in vitro [621] TAAGTGS
NKX3-2 ENSG00000109705 Homeodomain Known motif – High-throughput in vitro [622] TAAGTGS
NKX6-1 ENSG00000163623 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [623] DTDATNR
NKX6-2 ENSG00000148826 Homeodomain Known motif – High-throughput in vitro [624] DTAATTR
NKX6-3 ENSG00000165066 Homeodomain Known motif – High-throughput in vitro [625] WTAATGRB
NME2 ENSG00000243678 Unknown Likely sequence specific TF according to literature or domain structure – No motif [626]
NOBOX ENSG00000106410 Homeodomain Known motif – High-throughput in vitro [627] HDATDR
NOTO ENSG00000214513 Homeodomain Known motif – High-throughput in vitro [628] YWMATTA
NPAS1 ENSG00000130751 bHLH Inferred motif from similar protein – In vivo/Misc source [629] VVNGCACGTMBNS
NPAS2 ENSG00000170485 bHLH Known motif – High-throughput in vitro [630] DMCACGTGY
NPAS3 ENSG00000151322 bHLH Inferred motif from similar protein – In vivo/Misc source [631] VVNGCACGTMBNS
NPAS4 ENSG00000174576 bHLH Inferred motif from similar protein – High-throughput in vitro [632]
NR0B1 ENSG00000169297 Unknown Known motif – In vivo/Misc source [633] YBTYCCMCKS
NR1D1 ENSG00000126368 Nuclear receptor Known motif – High-throughput in vitro [634] TGACCYASTRACCYANWW
NR1D2 ENSG00000174738 Nuclear receptor Known motif – High-throughput in vitro [635] YRACMYANTRACMYMNWWH
NR1H2 ENSG00000131408 Nuclear receptor Known motif – In vivo/Misc source [636] TAAAGGTCAAAGGTCAASK
NR1H3 ENSG00000025434 Nuclear receptor Inferred motif from similar protein – In vivo/Misc source [637] TAAAGGTCAAAGGTCAASK
NR1H4 ENSG00000012504 Nuclear receptor Known motif – High-throughput in vitro [638] RGKTCRTTGACCYBNNRGGTBADRGKKBNDRGKTCAHHKD
NR1I2 ENSG00000144852 Nuclear receptor Known motif – High-throughput in vitro [639] YGMMCYBNNYGMMCY
NR1I3 ENSG00000143257 Nuclear receptor Known motif – High-throughput in vitro [640] RGKDYRNNNNRGKKYR
NR2C1 ENSG00000120798 Nuclear receptor Known motif – High-throughput in vitro [641] RGKKCRYGAMMY
NR2C2 ENSG00000177463 Nuclear receptor Known motif – High-throughput in vitro [642] VRGGTCAAAGGTCA
NR2E1 ENSG00000112333 Nuclear receptor Known motif – High-throughput in vitro [643] AAGTCA
NR2E3 ENSG00000278570 Nuclear receptor Known motif – High-throughput in vitro [644] RAGATCAM
NR2F1 ENSG00000175745 Nuclear receptor Known motif – High-throughput in vitro [645] RRGGTCAAAGGTCA
NR2F2 ENSG00000185551 Nuclear receptor Known motif – from protein with 100% identical DBD – in vitro [646] RRGGTCA
NR2F6 ENSG00000160113 Nuclear receptor Known motif – High-throughput in vitro [647] RGGTCAAAGGTCA
NR3C1 ENSG00000113580 Nuclear receptor Known motif – High-throughput in vitro [648] RGWACAYNRTGTWCYH
NR3C2 ENSG00000151623 Nuclear receptor Known motif – High-throughput in vitro [649] RGDACAHDRTGTHCY
NR4A1 ENSG00000123358 Nuclear receptor Known motif – High-throughput in vitro [650] AAAGGTCA
NR4A2 ENSG00000153234 Nuclear receptor Known motif – High-throughput in vitro [651] BTAAAGGTCA
NR4A3 ENSG00000119508 Nuclear receptor Known motif – In vivo/Misc source [652] CAAAGGTCAS
NR5A1 ENSG00000136931 Nuclear receptor Known motif – High-throughput in vitro [653] CAAGGYCR
NR5A2 ENSG00000116833 Nuclear receptor Known motif – High-throughput in vitro [654] YCAAGGTCAH
NR6A1 ENSG00000148200 Nuclear receptor Known motif – High-throughput in vitro [655] SAAGKTCAAGKKYR
NRF1 ENSG00000106459 Unknown Known motif – High-throughput in vitro [656] YRCGCATGCGC
NRL ENSG00000129535 bZIP Known motif – High-throughput in vitro [657] DWHNYGCTGAC
OLIG1 ENSG00000184221 bHLH Known motif – High-throughput in vitro [658] AVCATATGKT
OLIG2 ENSG00000205927 bHLH Known motif – High-throughput in vitro [659] AMCATATGKY
OLIG3 ENSG00000177468 bHLH Known motif – High-throughput in vitro [660] RSCATATGKY
ONECUT1 ENSG00000169856 CUT; Homeodomain Known motif – High-throughput in vitro [661] DDTATCGATYD
ONECUT2 ENSG00000119547 CUT; Homeodomain Known motif – High-throughput in vitro [662] DTATCGATCS
ONECUT3 ENSG00000205922 CUT; Homeodomain Known motif – High-throughput in vitro [663] DWTATYGATTTTY
OSR1 ENSG00000143867 C2H2 ZF Known motif – High-throughput in vitro [664] HACRGTAGC
OSR2 ENSG00000164920 C2H2 ZF Known motif – High-throughput in vitro [665] HVCRGTAGC
OTP ENSG00000171540 Homeodomain Known motif – from protein with 100% identical DBD – in vitro [666] HAATND
OTX1 ENSG00000115507 Homeodomain Known motif – High-throughput in vitro [667] TAATCSB
OTX2 ENSG00000165588 Homeodomain Known motif – High-throughput in vitro [668] HTAATCCB
OVOL1 ENSG00000172818 C2H2 ZF Known motif – High-throughput in vitro [669] RNRTAACGGTHH
OVOL2 ENSG00000125850 C2H2 ZF Known motif – High-throughput in vitro [670] DNNTARCGGD
OVOL3 ENSG00000105261 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [671]
PA2G4 ENSG00000170515 Unknown Likely sequence specific TF according to literature or domain structure – No motif [672]
PATZ1 ENSG00000100105 C2H2 ZF; AT hook Known motif – In vivo/Misc source [673] GGGHGGGG
PAX1 ENSG00000125813 Paired box Known motif – High-throughput in vitro [674] SGTCACGCWTSANTGVH
PAX2 ENSG00000075891 Homeodomain; Paired box Known motif – High-throughput in vitro [675] SGTCACGCWTSRNTGVNY
PAX3 ENSG00000135903 Homeodomain; Paired box Known motif – High-throughput in vitro [676] TAATCRATTA
PAX4 ENSG00000106331 Homeodomain; Paired box Known motif – High-throughput in vitro [677] HKAATTAR
PAX5 ENSG00000196092 Paired box Known motif – High-throughput in vitro [678] GTYACGSWTSRNTRVNY
PAX6 ENSG00000007372 Homeodomain; Paired box Known motif – High-throughput in vitro [679] YACGCHYSRNYRMNY
PAX7 ENSG00000009709 Homeodomain; Paired box Known motif – High-throughput in vitro [680] TAATYRATTW
PAX8 ENSG00000125618 Paired box Known motif – High-throughput in vitro [681] RNBYRNYSRWGCGTGACS
PAX9 ENSG00000198807 Paired box Known motif – High-throughput in vitro [682] SGTCACGCWTSANTGM
PBX1 ENSG00000185630 Homeodomain Known motif – High-throughput in vitro [683] TGATKGAYR
PBX2 ENSG00000204304 Homeodomain Known motif – In vivo/Misc source [684] KRVHKTGATTGAWK
PBX3 ENSG00000167081 Homeodomain Known motif – In vivo/Misc source [685] BBBTGATTGRYND
PBX4 ENSG00000105717 Homeodomain Known motif – High-throughput in vitro [686] HDWHH
PCGF2 ENSG00000277258 Unknown Likely sequence specific TF according to literature or domain structure – No motif [687]
PCGF6 ENSG00000156374 Unknown Likely sequence specific TF according to literature or domain structure – No motif [688]
PDX1 ENSG00000139515 Homeodomain Known motif – High-throughput in vitro [689] BTAATKR
PEG3 ENSG00000198300 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [690]
PGR ENSG00000082175 Nuclear receptor Known motif – High-throughput in vitro [691] RGNACRNNNTGTNCH
PHF1 ENSG00000112511 Unknown Known motif – High-throughput in vitro [692]
PHF19 ENSG00000119403 Unknown Likely sequence specific TF according to literature or domain structure – No motif [693]
PHF20 ENSG00000025293 AT hook Likely sequence specific TF according to literature or domain structure – No motif [694]
PHF21A ENSG00000135365 AT hook Likely sequence specific TF according to literature or domain structure – No motif [695]
PHOX2A ENSG00000165462 Homeodomain Known motif – High-throughput in vitro [696] TAATTRVRTTA
PHOX2B ENSG00000109132 Homeodomain Known motif – High-throughput in vitro [697] TAATTRVRTTA
PIN1 ENSG00000127445 MBD Likely sequence specific TF according to literature or domain structure – No motif [698]
PITX1 ENSG00000069011 Homeodomain Known motif – High-throughput in vitro [699] HTAATCC
PITX2 ENSG00000164093 Homeodomain Known motif – High-throughput in vitro [700] TAAKCC
PITX3 ENSG00000107859 Homeodomain Known motif – High-throughput in vitro [701] HTAATCC
PKNOX1 ENSG00000160199 Homeodomain Known motif – High-throughput in vitro [702] TGACAGCTGTCA
PKNOX2 ENSG00000165495 Homeodomain Known motif – High-throughput in vitro [703] TGACAGSTGTCA
PLAG1 ENSG00000181690 C2H2 ZF Known motif – High-throughput in vitro [704] GGGGCCHWMGGGGG
PLAGL1 ENSG00000118495 C2H2 ZF Known motif – In vivo/Misc source [705] RGGCCCCCYB
PLAGL2 ENSG00000126003 C2H2 ZF Known motif – High-throughput in vitro [706] RGGGGCCC
PLSCR1 ENSG00000188313 Unknown Likely sequence specific TF according to literature or domain structure – No motif [707]
POGK ENSG00000143157 Brinker Likely sequence specific TF according to literature or domain structure – No motif [708]
POU1F1 ENSG00000064835 Homeodomain; POU Known motif – High-throughput in vitro [709] DWTATGCWAATKAD
POU2AF1 ENSG00000110777 Unknown Known motif – In vivo/Misc source [710] GATKTGCAKAT
POU2F1 ENSG00000143190 Homeodomain; POU Known motif – High-throughput in vitro [711] WTGMATATKYADD
POU2F2 ENSG00000028277 Homeodomain; POU Known motif – High-throughput in vitro [712] DTGMATATKYADD
POU2F3 ENSG00000137709 Homeodomain; POU Known motif – High-throughput in vitro [713] TATGYWAAT
POU3F1 ENSG00000185668 Homeodomain; POU Known motif – High-throughput in vitro [714] WTATGYWAATD
POU3F2 ENSG00000184486 Homeodomain; POU Known motif – High-throughput in vitro [715] WTATGYWAATKW
POU3F3 ENSG00000198914 Homeodomain; POU Known motif – High-throughput in vitro [716] WWDMWTAWKHAW
POU3F4 ENSG00000196767 Homeodomain; POU Known motif – High-throughput in vitro [717] WDAWTTATKCA
POU4F1 ENSG00000152192 Homeodomain; POU Known motif – High-throughput in vitro [718] TDMATWATKYA
POU4F2 ENSG00000151615 Homeodomain; POU Known motif – High-throughput in vitro [719] BTMATTAAWTATKCA
POU4F3 ENSG00000091010 Homeodomain; POU Known motif – High-throughput in vitro [720] RTNMATWATKYAT
POU5F1 ENSG00000204531 Homeodomain; POU Known motif – High-throughput in vitro [721] WTATGYWAATKWVB
POU5F1B ENSG00000212993 Homeodomain; POU Known motif – High-throughput in vitro [722] TATGYWAAT
POU5F2 ENSG00000248483 Homeodomain; POU Likely sequence specific TF according to literature or domain structure – No motif [723]
POU6F1 ENSG00000184271 Homeodomain; POU Known motif – High-throughput in vitro [724] MTCATTAH
POU6F2 ENSG00000106536 Homeodomain; POU Known motif – High-throughput in vitro [725] DTAATKAGBH
PPARA ENSG00000186951 Nuclear receptor Known motif – In vivo/Misc source [726] DAGGTCA
PPARD ENSG00000112033 Nuclear receptor Known motif – High-throughput in vitro [727] RRGGTCAAAGGTCA
PPARG ENSG00000132170 Nuclear receptor Known motif – from protein with 100% identical DBD – in vitro [728] VNTRMCCYANWDNRACCTWTNVCCYVNW
PRDM1 ENSG00000057657 C2H2 ZF Known motif – High-throughput in vitro [729] RAAAGTGAAAGTD
PRDM10 ENSG00000170325 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [730]
PRDM12 ENSG00000130711 C2H2 ZF Known motif – In vivo/Misc source [731] GACAGNTKACC
PRDM13 ENSG00000112238 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [732]
PRDM14 ENSG00000147596 C2H2 ZF Known motif – In vivo/Misc source [733] RSTTAGRGACCY
PRDM15 ENSG00000141956 C2H2 ZF Known motif – In vivo/Misc source [734] DTGGAAHTCCMA
PRDM16 ENSG00000142611 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [735] DAGAYAAGATAANM
PRDM2 ENSG00000116731 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [736]
PRDM4 ENSG00000110851 C2H2 ZF Known motif – High-throughput in vitro [737] TTTCAAGGCCCCC
PRDM5 ENSG00000138738 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [738]
PRDM6 ENSG00000061455 C2H2 ZF Known motif – In vivo/Misc source [739] RVARDRRAAADDVWRRAAAA
PRDM8 ENSG00000152784 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [740]
PRDM9 ENSG00000164256 C2H2 ZF Known motif – High-throughput in vitro [741] VGNGGBNRSGGDGGNNNNARVRRV
PREB ENSG00000138073 Unknown Likely sequence specific TF according to literature or domain structure – No motif [742]
PRMT3 ENSG00000185238 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [743]
PROP1 ENSG00000175325 Homeodomain Known motif – High-throughput in vitro [744] TAAYYNMATTA
PROX1 ENSG00000117707 Prospero Known motif – High-throughput in vitro [745] BAAGACGYCTTV
PROX2 ENSG00000119608 Prospero Inferred motif from similar protein – High-throughput in vitro [746] BAMGRCGTCDTV
PRR12 ENSG00000126464 AT hook Likely sequence specific TF according to literature or domain structure – No motif [747]
PRRX1 ENSG00000116132 Homeodomain Known motif – High-throughput in vitro [748] TAATTR
PRRX2 ENSG00000167157 Homeodomain Known motif – High-throughput in vitro [749] TAATTRV
PTF1A ENSG00000168267 bHLH Known motif – High-throughput in vitro [750] VYGTCAGCTGTT
PURA ENSG00000185129 Unknown Known motif – In vivo/Misc source [751] CYMBGSCHNCMMMBWCC
PURB ENSG00000146676 Unknown Likely sequence specific TF according to literature or domain structure – No motif [752]
PURG ENSG00000172733 Unknown Likely sequence specific TF according to literature or domain structure – No motif [753]
RAG1 ENSG00000166349 Unknown Likely sequence specific TF according to literature or domain structure – No motif [754]
RARA ENSG00000131759 Nuclear receptor Known motif – High-throughput in vitro [755] RRGGTCANV
RARB ENSG00000077092 Nuclear receptor Known motif – High-throughput in vitro [756] TGACCYYTTGACCYY
RARG ENSG00000172819 Nuclear receptor Known motif – High-throughput in vitro [757] VGGTCA
RAX ENSG00000134438 Homeodomain Known motif – High-throughput in vitro [758] HTAATTR
RAX2 ENSG00000173976 Homeodomain Known motif – High-throughput in vitro [759] TAATTR
RBAK ENSG00000146587 C2H2 ZF Known motif – High-throughput in vitro [760] VGDRASRARVRRSV
RBCK1 ENSG00000125826 Unknown Likely sequence specific TF according to literature or domain structure – No motif [761]
RBPJ ENSG00000168214 CSL Known motif – High-throughput in vitro [762] BTCHCA
RBPJL ENSG00000124232 CSL Inferred motif from similar protein – In vivo/Misc source [763] DTTCCCABR
RBSN ENSG00000131381 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [764]
REL ENSG00000162924 Rel Known motif – In vivo/Misc source [765] GGAAWNYCCV
RELA ENSG00000173039 Rel Known motif – In vivo/Misc source [766] BKGGAAAKYCCCH
RELB ENSG00000104856 Rel Known motif – In vivo/Misc source [767] DKSAAAKYCCCB
REPIN1 ENSG00000214022 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [768]
REST ENSG00000084093 C2H2 ZF Known motif – In vivo/Misc source [769] DTCAGSACCWYGGACAGCDSC
REXO4 ENSG00000148300 Unknown Likely sequence specific TF according to literature or domain structure – No motif [770]
RFX1 ENSG00000132005 RFX Known motif – High-throughput in vitro [771] BGTTRYCATGRYAACV
RFX2 ENSG00000087903 RFX Known motif – High-throughput in vitro [772] BGTTRCCATGGYAACV
RFX3 ENSG00000080298 RFX Known motif – High-throughput in vitro [773] BGTTDCCATGGYAAC
RFX4 ENSG00000111783 RFX Known motif – High-throughput in vitro [774] GTWRYCATRGHWAC
RFX5 ENSG00000143390 RFX Known motif – High-throughput in vitro [775] BGTTGCYATGGYAACV
RFX6 ENSG00000185002 RFX Inferred motif from similar protein – High-throughput in vitro [776] GTHDYYNNS
RFX7 ENSG00000181827 RFX Known motif – High-throughput in vitro [777] BGTTRCYRY
RFX8 ENSG00000196460 RFX Likely sequence specific TF according to literature or domain structure – No motif [778]
RHOXF1 ENSG00000101883 Homeodomain Known motif – High-throughput in vitro [779] TRAKCCH
RHOXF2 ENSG00000131721 Homeodomain Known motif – High-throughput in vitro [780] TAATCC
RHOXF2B ENSG00000203989 Homeodomain Inferred motif from similar protein – High-throughput in vitro [781] TAATCC
RLF ENSG00000117000 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [782]
RORA ENSG00000069667 Nuclear receptor Known motif – High-throughput in vitro [783] MRAGGTCAAVYYVAGGTCA
RORB ENSG00000198963 Nuclear receptor Known motif – High-throughput in vitro [784] AWNBRGGTCA
RORC ENSG00000143365 Nuclear receptor Known motif – High-throughput in vitro [785] TGMCCYANWTH
RREB1 ENSG00000124782 C2H2 ZF Known motif – In vivo/Misc source [786] MCMCMAMMCAMCMMCHMMSV
RUNX1 ENSG00000159216 Runt Known motif – In vivo/Misc source [787] VACCACAV
RUNX2 ENSG00000124813 Runt Known motif – High-throughput in vitro [788] HRACCRCADWAACCRCAV
RUNX3 ENSG00000020633 Runt Known motif – High-throughput in vitro [789] WAACCRCAR
RXRA ENSG00000186350 Nuclear receptor Known motif – High-throughput in vitro [790] RRGGTCAAAGGTCA
RXRB ENSG00000204231 Nuclear receptor Known motif – High-throughput in vitro [791] RRGGTCAAAGGTCA
RXRG ENSG00000143171 Nuclear receptor Known motif – High-throughput in vitro [792] RRGGTCAAAGGTCA
SAFB ENSG00000160633 Unknown Likely sequence specific TF according to literature or domain structure – No motif [793]
SAFB2 ENSG00000130254 Unknown Likely sequence specific TF according to literature or domain structure – No motif [794]
SALL1 ENSG00000103449 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [795] RYYCAAAAB
SALL2 ENSG00000165821 C2H2 ZF Known motif – In vivo/Misc source [796] CCCACCC
SALL3 ENSG00000256463 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [797]
SALL4 ENSG00000101115 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [798] GCTGATAACAGV
SATB1 ENSG00000182568 CUT; Homeodomain Known motif – In vivo/Misc source [799] WKWWWTAAHGRYMNWW
SATB2 ENSG00000119042 CUT; Homeodomain Inferred motif from similar protein – In vivo/Misc source [800] WKWWWTAAHGRYMNWW
SCMH1 ENSG00000010803 Unknown Likely sequence specific TF according to literature or domain structure – No motif [801]
SCML4 ENSG00000146285 AT hook Likely sequence specific TF according to literature or domain structure – No motif [802]
SCRT1 ENSG00000261678 C2H2 ZF Known motif – High-throughput in vitro [803] KCAACAGGTD
SCRT2 ENSG00000215397 C2H2 ZF Known motif – High-throughput in vitro [804] RHGCAACAGGTGB
SCX ENSG00000260428 bHLH Inferred motif from similar protein – High-throughput in vitro [805] VCRKMYGB
SEBOX ENSG00000274529 Homeodomain Inferred motif from similar protein – High-throughput in vitro [806] HTTAATTA
SETBP1 ENSG00000152217 AT hook Likely sequence specific TF according to literature or domain structure – No motif [807]
SETDB1 ENSG00000143379 MBD Known motif – In vivo/Misc source [808] RACTHCMDYTCCCRKVRDGCHNYG
SETDB2 ENSG00000136169 MBD Likely sequence specific TF according to literature or domain structure – No motif [809]
SGSM2 ENSG00000141258 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [810]
SHOX ENSG00000185960 Homeodomain Known motif – High-throughput in vitro [811] TAATTR
SHOX2 ENSG00000168779 Homeodomain Known motif – High-throughput in vitro [812] BTAATTR
SIM1 ENSG00000112246 bHLH Inferred motif from similar protein – In vivo/Misc source [813] VVNGCACGTMBNS
SIM2 ENSG00000159263 bHLH Inferred motif from similar protein – In vivo/Misc source [814] VVNGCACGTMBNS
SIX1 ENSG00000126778 Homeodomain Known motif – High-throughput in vitro [815] VBGTATCR
SIX2 ENSG00000170577 Homeodomain Known motif – High-throughput in vitro [816] VSGTATCR
SIX3 ENSG00000138083 Homeodomain Known motif – High-throughput in vitro [817] VVTATCR
SIX4 ENSG00000100625 Homeodomain Known motif – High-throughput in vitro [818] VBGTATCRB
SIX5 ENSG00000177045 Homeodomain Known motif – In vivo/Misc source [819] GGAGTTGT
SIX6 ENSG00000184302 Homeodomain Known motif – High-throughput in vitro [820] VBSTATCR
SKI ENSG00000157933 Unknown Likely sequence specific TF according to literature or domain structure – No motif [821]
SKIL ENSG00000136603 Unknown Likely sequence specific TF according to literature or domain structure – No motif [822]
SKOR1 ENSG00000188779 Unknown Known motif – High-throughput in vitro [823] WNVKGTAATTAMB
SKOR2 ENSG00000215474 SAND Known motif – High-throughput in vitro [824] WNVKGTAATTAA
SLC2A4RG ENSG00000125520 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [825]
SMAD1 ENSG00000170365 SMAD Known motif – In vivo/Misc source [826] DRCAGASAGGSH
SMAD3 ENSG00000166949 SMAD Known motif – High-throughput in vitro [827] YGTCTAGACA
SMAD4 ENSG00000141646 SMAD Known motif – from protein with 100% identical DBD – in vitro [828] KCYAGACR
SMAD5 ENSG00000113658 SMAD Known motif – High-throughput in vitro [829] YGTCTAGACW
SMAD9 ENSG00000120693 SMAD Known motif – In vivo/Misc source [830] WGGTCTAGMCMT
SMYD3 ENSG00000185420 Unknown Likely sequence specific TF according to literature or domain structure – No motif [831]
SNAI1 ENSG00000124216 C2H2 ZF Known motif – High-throughput in vitro [832] VCACCTGY
SNAI2 ENSG00000019549 C2H2 ZF Known motif – High-throughput in vitro [833] RRCAGGTGYR
SNAI3 ENSG00000185669 C2H2 ZF Known motif – High-throughput in vitro [834] DRCAGGTGYR
SNAPC2 ENSG00000104976 Unknown Likely sequence specific TF according to literature or domain structure – No motif [835]
SNAPC4 ENSG00000165684 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [836]
SNAPC5 ENSG00000174446 Unknown Likely sequence specific TF according to literature or domain structure – No motif [837]
SOHLH1 ENSG00000165643 bHLH Likely sequence specific TF according to literature or domain structure – No motif [838]
SOHLH2 ENSG00000120669 bHLH Known motif – High-throughput in vitro [839] BCACGTGC
SON ENSG00000159140 Unknown Likely sequence specific TF according to literature or domain structure – No motif [840]
SOX1 ENSG00000182968 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [841] WBAAW
SOX10 ENSG00000100146 HMG/Sox Known motif – High-throughput in vitro [842] DAACAWWGVV
SOX11 ENSG00000176887 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [843] VACAAW
SOX12 ENSG00000177732 HMG/Sox Known motif – High-throughput in vitro [844] MCCGAACAAT
SOX13 ENSG00000143842 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [845] RAACAATW
SOX14 ENSG00000168875 HMG/Sox Known motif – High-throughput in vitro [846] WCAATR
SOX15 ENSG00000129194 HMG/Sox Known motif – High-throughput in vitro [847] ATCAATAMCATTGAT
SOX17 ENSG00000164736 HMG/Sox Known motif – High-throughput in vitro [848] DRACAATRV
SOX18 ENSG00000203883 HMG/Sox Known motif – High-throughput in vitro [849] ATCAATGHWATTGAT
SOX2 ENSG00000181449 HMG/Sox Known motif – High-throughput in vitro [850] HATCAATANCATTGATH
SOX21 ENSG00000125285 HMG/Sox Known motif – High-throughput in vitro [851] TCAMTRHCATTGA
SOX3 ENSG00000134595 HMG/Sox Known motif – High-throughput in vitro [852] SBNAMAATRB
SOX30 ENSG00000039600 HMG/Sox Known motif – High-throughput in vitro [853] RACAAT
SOX4 ENSG00000124766 HMG/Sox Known motif – High-throughput in vitro [854] AACAAWGR
SOX5 ENSG00000134532 HMG/Sox Known motif – High-throughput in vitro [855] DVACAATRV
SOX6 ENSG00000110693 HMG/Sox Known motif – High-throughput in vitro [856] DRACAATRV
SOX7 ENSG00000171056 HMG/Sox Known motif – High-throughput in vitro [857] DAACAATKDYAKTGTT
SOX8 ENSG00000005513 HMG/Sox Known motif – High-throughput in vitro [858] HATCAATTKCAGTGAT
SOX9 ENSG00000125398 HMG/Sox Known motif – High-throughput in vitro [859] DDACAATRV
SP1 ENSG00000185591 C2H2 ZF Known motif – High-throughput in vitro [860] RCCMCDCCCMH
SP100 ENSG00000067066 SAND Likely sequence specific TF according to literature or domain structure – No motif [861]
SP110 ENSG00000135899 SAND Likely sequence specific TF according to literature or domain structure – No motif [862]
SP140 ENSG00000079263 SAND Likely sequence specific TF according to literature or domain structure – No motif [863]
SP140L ENSG00000185404 SAND Likely sequence specific TF according to literature or domain structure – No motif [864]
SP2 ENSG00000167182 C2H2 ZF Known motif – High-throughput in vitro [865] YWAGYCCCGCCCMCYH
SP3 ENSG00000172845 C2H2 ZF Known motif – High-throughput in vitro [866] VCCMCRCCCMY
SP4 ENSG00000105866 C2H2 ZF Known motif – High-throughput in vitro [867] WRGCCACGCCCMCHY
SP5 ENSG00000204335 C2H2 ZF Known motif – In vivo/Misc source [868] ACCVCGCCKCCSS
SP6 ENSG00000189120 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [869] HNGCCACGCCCARK
SP7 ENSG00000170374 C2H2 ZF Known motif – In vivo/Misc source [870] VBNSGGGGNGG
SP8 ENSG00000164651 C2H2 ZF Known motif – High-throughput in vitro [871] VMCACBCCCMCH
SP9 ENSG00000217236 C2H2 ZF Known motif – High-throughput in vitro [872] VMCMCGCCCMYH
SPDEF ENSG00000124664 Ets Known motif – High-throughput in vitro [873] AMCCGGATRTD
SPEN ENSG00000065526 Unknown Likely sequence specific TF according to literature or domain structure – No motif [874]
SPI1 ENSG00000066336 Ets Known motif – High-throughput in vitro [875] RAAAAGMGGAAGTW
SPIB ENSG00000269404 Ets Known motif – High-throughput in vitro [876] WWWRVGGAAST
SPIC ENSG00000166211 Ets Known motif – High-throughput in vitro [877] RAAWSVGGAAGTM
SPZ1 ENSG00000164299 Unknown Known motif – In vivo/Misc source [878] GGSDGWWMCVBHBG
SRCAP ENSG00000080603 AT hook Likely sequence specific TF according to literature or domain structure – No motif [879]
SREBF1 ENSG00000072310 bHLH Known motif – High-throughput in vitro [880] VHCACVCSAY
SREBF2 ENSG00000198911 bHLH Known motif – High-throughput in vitro [881] RTCACGTGAY
SRF ENSG00000112658 MADS box Known motif – High-throughput in vitro [882] DCCWTATATGGT
SRY ENSG00000184895 HMG/Sox Known motif – High-throughput in vitro [883] AACAATGNTATTGTT
ST18 ENSG00000147488 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [884] VAAGTTT
STAT1 ENSG00000115415 STAT Known motif – In vivo/Misc source [885] HTTCCYRGAAR
STAT2 ENSG00000170581 STAT Known motif – In vivo/Misc source [886] TNRGTTTCDNTTYC
STAT3 ENSG00000168610 STAT Known motif – In vivo/Misc source [887] HTTCCYRKMA
STAT4 ENSG00000138378 STAT Known motif – In vivo/Misc source [888] BDHTTCTBGKAAD
STAT5A ENSG00000126561 STAT Known motif – In vivo/Misc source [889] YTTCYNRGAAHY
STAT5B ENSG00000173757 STAT Known motif – In vivo/Misc source [890] ADTTCYHRGAAA
STAT6 ENSG00000166888 STAT Known motif – In vivo/Misc source [891] DWTTYCNDDGAA
T ENSG00000164458 T-box Known motif – High-throughput in vitro [892] ANGTGYGAHWWNTVRCACCT
TAL1 ENSG00000162367 bHLH Known motif – In vivo/Misc source [893] RNCAGVTGGH
TAL2 ENSG00000186051 bHLH Inferred motif from similar protein – In vivo/Misc source [894] RNCAGVTGGH
TBP ENSG00000112592 TBP Known motif – from protein with 100% identical DBD – in vitro [895] WWWWAW
TBPL1 ENSG00000028839 TBP Likely sequence specific TF according to literature or domain structure – No motif [896]
TBPL2 ENSG00000182521 TBP Inferred motif from similar protein – High-throughput in vitro [897] WWWWAW
TBR1 ENSG00000136535 T-box Known motif – High-throughput in vitro [898] TTCACACCT
TBX1 ENSG00000184058 T-box Known motif – High-throughput in vitro [899] TCACACCT
TBX10 ENSG00000167800 T-box Inferred motif from similar protein – High-throughput in vitro [900] BYTCACACCYHV
TBX15 ENSG00000092607 T-box Known motif – High-throughput in vitro [901] TCACACCT
TBX18 ENSG00000112837 T-box Known motif – High-throughput in vitro [902] BYTCACACCTHH
TBX19 ENSG00000143178 T-box Known motif – High-throughput in vitro [903] TMRCACNTABGTGYBAH
TBX2 ENSG00000121068 T-box Known motif – High-throughput in vitro [904] VRCRC
TBX20 ENSG00000164532 T-box Known motif – High-throughput in vitro [905] TCACRCBYTMACACCT
TBX21 ENSG00000073861 T-box Known motif – High-throughput in vitro [906] WTCACACCTH
TBX22 ENSG00000122145 T-box Known motif – In vivo/Misc source [907] AGGTGWSAAWTTCACACCT
TBX3 ENSG00000135111 T-box Known motif – High-throughput in vitro [908] YVACACSH
TBX4 ENSG00000121075 T-box Known motif – High-throughput in vitro [909] TVACACCT
TBX5 ENSG00000089225 T-box Known motif – High-throughput in vitro [910] TVACACCT
TBX6 ENSG00000149922 T-box Known motif – High-throughput in vitro [911] TVACACSY
TCF12 ENSG00000140262 bHLH Known motif – High-throughput in vitro [912] VCACSTGB
TCF15 ENSG00000125878 bHLH Inferred motif from similar protein – High-throughput in vitro [913] VCRKMYGB
TCF20 ENSG00000100207 Unknown Likely sequence specific TF according to literature or domain structure – No motif [914]
TCF21 ENSG00000118526 bHLH Known motif – High-throughput in vitro [915] RVCAGCTGTTV
TCF23 ENSG00000163792 bHLH Inferred motif from similar protein – High-throughput in vitro [916] VCRKMYGB
TCF24 ENSG00000261787 bHLH Inferred motif from similar protein – High-throughput in vitro [917] RMCAKMTGK
TCF3 ENSG00000071564 bHLH Known motif – High-throughput in vitro [918] VCAGGTGB
TCF4 ENSG00000196628 bHLH Known motif – High-throughput in vitro [919] HRCACCTGB
TCF7 ENSG00000081059 HMG/Sox Known motif – High-throughput in vitro [920] DSATCAAWS
TCF7L1 ENSG00000152284 HMG/Sox Known motif – High-throughput in vitro [921] AAAGATCAAAGG
TCF7L2 ENSG00000148737 HMG/Sox Known motif – from protein with 100% identical DBD – in vitro [922] SWTCAAAV
TCFL5 ENSG00000101190 bHLH Known motif – High-throughput in vitro [923] KCRCGCGCHC
TEAD1 ENSG00000187079 TEA Known motif – High-throughput in vitro [924] RCATTCCDH
TEAD2 ENSG00000074219 TEA Known motif – High-throughput in vitro [925] YRCATTCCW
TEAD3 ENSG00000007866 TEA Known motif – High-throughput in vitro [926] RCATTCYDNDCATWCCD
TEAD4 ENSG00000197905 TEA Known motif – High-throughput in vitro [927] RMATTCYD
TEF ENSG00000167074 bZIP Known motif – High-throughput in vitro [928] VTTACRTAAB
TERB1 ENSG00000249961 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [929]
TERF1 ENSG00000147601 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [930]
TERF2 ENSG00000132604 Myb/SANT Inferred motif from similar protein – High-throughput in vitro [931] AACCCTAV
TET1 ENSG00000138336 CxxC Known motif – High-throughput in vitro [932] HVCGH
TET2 ENSG00000168769 Unknown Likely sequence specific TF according to literature or domain structure – No motif [933]
TET3 ENSG00000187605 CxxC Likely sequence specific TF according to literature or domain structure – No motif [934]
TFAP2A ENSG00000137203 AP-2 Known motif – High-throughput in vitro [935] HSCCYBVRGGCD
TFAP2B ENSG00000008196 AP-2 Known motif – High-throughput in vitro [936] SCCBNVGGS
TFAP2C ENSG00000087510 AP-2 Known motif – High-throughput in vitro [937] HGCCYBVRGGSD
TFAP2D ENSG00000008197 AP-2 Known motif – In vivo/Misc source [938] RCGNGCCBCRGVCB
TFAP2E ENSG00000116819 AP-2 Known motif – High-throughput in vitro [939] HSCCYSRGGSD
TFAP4 ENSG00000090447 bHLH Known motif – High-throughput in vitro [940] VWCAGCTGWB
TFCP2 ENSG00000135457 Grainyhead Known motif – High-throughput in vitro [941] WCCGGWWHDAWCYGGW
TFCP2L1 ENSG00000115112 Grainyhead Known motif – High-throughput in vitro [942] DCYRGHNNNDDCYRGH
TFDP1 ENSG00000198176 E2F Known motif – In vivo/Misc source [943] DYYTCSCGCYMWWY
TFDP2 ENSG00000114126 E2F Inferred motif from similar protein – In vivo/Misc source [944] DYYTCSCGCYMWWY
TFDP3 ENSG00000183434 E2F Inferred motif from similar protein – In vivo/Misc source [945] DYYTCSCGCYMWWY
TFE3 ENSG00000068323 bHLH Known motif – High-throughput in vitro [946] RKCACGTGNB
TFEB ENSG00000112561 bHLH Known motif – High-throughput in vitro [947] RNCACGTGAY
TFEC ENSG00000105967 bHLH Known motif – High-throughput in vitro [948] RNCACRTGAB
TGIF1 ENSG00000177426 Homeodomain Known motif – High-throughput in vitro [949] TGACAGCTGTCA
TGIF2 ENSG00000118707 Homeodomain Known motif – High-throughput in vitro [950] TGACABVTGTCA
TGIF2LX ENSG00000153779 Homeodomain Known motif – High-throughput in vitro [951] TGACASSTGTCA
TGIF2LY ENSG00000176679 Homeodomain Known motif – High-throughput in vitro [952] TGACABVTGTCA
THAP1 ENSG00000131931 THAP finger Known motif – In vivo/Misc source [953] BYYGCCMKNANYMAAVATGGCSV
THAP10 ENSG00000129028 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [954]
THAP11 ENSG00000168286 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [955]
THAP12 ENSG00000137492 THAP finger Known motif – High-throughput in vitro [956] YMBNNBGR
THAP2 ENSG00000173451 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [957]
THAP3 ENSG00000041988 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [958]
THAP4 ENSG00000176946 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [959]
THAP5 ENSG00000177683 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [960]
THAP6 ENSG00000174796 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [961]
THAP7 ENSG00000184436 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [962]
THAP8 ENSG00000161277 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [963]
THAP9 ENSG00000168152 THAP finger Likely sequence specific TF according to literature or domain structure – No motif [964]
THRA ENSG00000126351 Nuclear receptor Known motif – High-throughput in vitro [965] DTGACCTBATRAGGTCAH
THRB ENSG00000151090 Nuclear receptor Known motif – High-throughput in vitro [966] TGWCCTBRNYVAGGWCA
THYN1 ENSG00000151500 Unknown Likely sequence specific TF according to literature or domain structure – No motif [967]
TIGD1 ENSG00000221944 CENPB Known motif – High-throughput in vitro [968] SCGCAATA
TIGD2 ENSG00000180346 CENPB Inferred motif from similar protein – High-throughput in vitro [969] RCGGWWR
TIGD3 ENSG00000173825 CENPB Likely sequence specific TF according to literature or domain structure – No motif [970]
TIGD4 ENSG00000169989 CENPB Likely sequence specific TF according to literature or domain structure – No motif [971]
TIGD5 ENSG00000179886 CENPB Likely sequence specific TF according to literature or domain structure – No motif [972]
TIGD6 ENSG00000164296 CENPB Inferred motif from similar protein – High-throughput in vitro [973] WVCRWA
TIGD7 ENSG00000140993 CENPB Likely sequence specific TF according to literature or domain structure – No motif [974]
TLX1 ENSG00000107807 Homeodomain Known motif – In vivo/Misc source [975] VCHHVTTRVCV
TLX2 ENSG00000115297 Homeodomain Known motif – High-throughput in vitro [976] BTAATTR
TLX3 ENSG00000164438 Homeodomain Known motif – High-throughput in vitro [977] AATKGNNNNNNNNNNNNNCAATT
TMF1 ENSG00000144747 Unknown Likely sequence specific TF according to literature or domain structure – No motif [978]
TOPORS ENSG00000197579 Unknown Known motif – In vivo/Misc source [979] TCCCAGCTACTTTGGGA
TP53 ENSG00000141510 p53 Known motif – In vivo/Misc source [980] DRCATGYYBRGRCATGYCY
TP63 ENSG00000073282 p53 Known motif – High-throughput in vitro [981] DACATGTYVYRACATGTY
TP73 ENSG00000078900 p53 Known motif – In vivo/Misc source [982] DRRCAWGYHCWGRCWTGYH
TPRX1 ENSG00000178928 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [983]
TRAFD1 ENSG00000135148 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [984]
TRERF1 ENSG00000124496 C2H2 ZF; Myb/SANT Inferred motif from similar protein – In vivo/Misc source [985] AGACKTTAGTCA
TRPS1 ENSG00000104447 GATA Known motif – In vivo/Misc source [986] HWSRARATAGWDDMH
TSC22D1 ENSG00000102804 Unknown Likely sequence specific TF according to literature or domain structure – No motif [987]
TSHZ1 ENSG00000179981 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [988]
TSHZ2 ENSG00000182463 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [989]
TSHZ3 ENSG00000121297 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [990]
TTF1 ENSG00000125482 Myb/SANT Likely sequence specific TF according to literature or domain structure – No motif [991]
TWIST1 ENSG00000122691 bHLH Known motif – In vivo/Misc source [992] MHVCACHTGSD
TWIST2 ENSG00000233608 bHLH Known motif – from protein with 100% identical DBD – in vitro [993] MCATATGT
UBP1 ENSG00000153560 Grainyhead Known motif – High-throughput in vitro [994] DCYRGHNNNNDCYRGH
UNCX ENSG00000164853 Homeodomain Known motif – High-throughput in vitro [995] TAATTR
USF1 ENSG00000158773 bHLH Known motif – High-throughput in vitro [996] RNCACGTGRY
USF2 ENSG00000105698 bHLH Known motif – High-throughput in vitro [997] VCACGTGVC
USF3 ENSG00000176542 bHLH Likely sequence specific TF according to literature or domain structure – No motif [998]
VAX1 ENSG00000148704 Homeodomain Known motif – High-throughput in vitro [999] YTAATKA
VAX2 ENSG00000116035 Homeodomain Known motif – High-throughput in vitro [1,000] YTAATKA
VDR ENSG00000111424 Nuclear receptor Known motif – High-throughput in vitro [1,001] TGAACYCDRTGAACYC
VENTX ENSG00000151650 Homeodomain Known motif – High-throughput in vitro [1,002] VNTAATBR
VEZF1 ENSG00000136451 C2H2 ZF Known motif – High-throughput in vitro [1,003] RKGGGGGG
VSX1 ENSG00000100987 Homeodomain Known motif – High-throughput in vitro [1,004] TAATTRS
VSX2 ENSG00000119614 Homeodomain Known motif – High-throughput in vitro [1,005] YTAATTA
WIZ ENSG00000011451 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,006]
WT1 ENSG00000184937 C2H2 ZF Known motif – High-throughput in vitro [1,007] BGGGGGRG
XBP1 ENSG00000100219 bZIP Known motif – High-throughput in vitro [1,008] GVTGACGTGKCVHW
XPA ENSG00000136936 Unknown Known motif – High-throughput in vitro [1,009] VCACCTCACMY
YBX1 ENSG00000065978 CSD Known motif – High-throughput in vitro [1,010] YGTWCCAYC
YBX2 ENSG00000006047 CSD Inferred motif from similar protein – High-throughput in vitro [1,011] YGTWCCAYC
YBX3 ENSG00000060138 CSD Known motif – from protein with 100% identical DBD – in vitro [1,012] YGTWCCAYC
YY1 ENSG00000100811 C2H2 ZF Known motif – High-throughput in vitro [1,013] HRWNATGGCB
YY2 ENSG00000230797 C2H2 ZF Known motif – High-throughput in vitro [1,014] DDNATGGCGG
ZBED1 ENSG00000214717 BED ZF Known motif – High-throughput in vitro [1,015] YATGTCGCGAYAD
ZBED2 ENSG00000177494 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,016]
ZBED3 ENSG00000132846 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,017]
ZBED4 ENSG00000100426 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,018]
ZBED5 ENSG00000236287 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,019]
ZBED6 ENSG00000257315 BED ZF Inferred motif from similar protein – In vivo/Misc source [1,020] VVRGCGAGCYYV
ZBED9 ENSG00000232040 BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,021]
ZBTB1 ENSG00000126804 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [1,022] HMMCGCRH
ZBTB10 ENSG00000205189 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,023]
ZBTB11 ENSG00000066422 C2H2 ZF Known motif – In vivo/Misc source [1,024] GGGGKGCRCMCA
ZBTB12 ENSG00000204366 C2H2 ZF Known motif – High-throughput in vitro [1,025] CTAGAACMB
ZBTB14 ENSG00000198081 C2H2 ZF Known motif – High-throughput in vitro [1,026] VDCGTGCACGCGCRH
ZBTB16 ENSG00000109906 C2H2 ZF Known motif – In vivo/Misc source [1,027] BTVNWYBKVHKBTAAADYWKKRHYWRDKY
ZBTB17 ENSG00000116809 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,028]
ZBTB18 ENSG00000179456 C2H2 ZF Known motif – High-throughput in vitro [1,029] DKCCAGATGTK
ZBTB2 ENSG00000181472 C2H2 ZF Known motif – High-throughput in vitro [1,030] DKWACCGGRA
ZBTB20 ENSG00000181722 C2H2 ZF Known motif – High-throughput in vitro [1,031] VYATACRTYV
ZBTB21 ENSG00000173276 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,032]
ZBTB22 ENSG00000236104 C2H2 ZF Known motif – High-throughput in vitro [1,033] HKCACWAYNRTWGTGMD
ZBTB24 ENSG00000112365 C2H2 ZF; AT hook Likely sequence specific TF according to literature or domain structure – No motif [1,034]
ZBTB25 ENSG00000089775 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,035]
ZBTB26 ENSG00000171448 C2H2 ZF Known motif – High-throughput in vitro [1,036] DHTCYAGAAHR
ZBTB3 ENSG00000185670 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [1,037] DSCAGYK
ZBTB32 ENSG00000011590 C2H2 ZF Known motif – High-throughput in vitro [1,038] HGTACAGTRWYACTGTACD
ZBTB33 ENSG00000177485 C2H2 ZF Known motif – In vivo/Misc source [1,039] SVNTCTCGCGAGANB
ZBTB34 ENSG00000177125 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,040] DTCGGCYAABDCGGCA
ZBTB37 ENSG00000185278 C2H2 ZF Known motif – High-throughput in vitro [1,041] DTCGGCYAABDCGGCA
ZBTB38 ENSG00000177311 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,042]
ZBTB39 ENSG00000166860 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,043]
ZBTB4 ENSG00000174282 C2H2 ZF Known motif – In vivo/Misc source [1,044] CVCHAHCRCYMTBG
ZBTB40 ENSG00000184677 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,045]
ZBTB41 ENSG00000177888 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,046]
ZBTB42 ENSG00000179627 C2H2 ZF Known motif – High-throughput in vitro [1,047] MRCAKCTGS
ZBTB43 ENSG00000169155 C2H2 ZF Known motif – High-throughput in vitro [1,048] GTGCTRNNNNNDDGGCAC
ZBTB44 ENSG00000196323 C2H2 ZF Known motif – High-throughput in vitro [1,049] RMTGCAKB
ZBTB45 ENSG00000119574 C2H2 ZF Known motif – High-throughput in vitro [1,050] BMTATAGGBR
ZBTB46 ENSG00000130584 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,051]
ZBTB47 ENSG00000114853 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,052]
ZBTB48 ENSG00000204859 C2H2 ZF Known motif – In vivo/Misc source [1,053] YHAGGGANHDD
ZBTB49 ENSG00000168826 C2H2 ZF Known motif – High-throughput in vitro [1,054] TGACVBGYCARGCRRAA
ZBTB5 ENSG00000168795 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,055]
ZBTB6 ENSG00000186130 C2H2 ZF Known motif – In vivo/Misc source [1,056] VGRTGMTRGAGCC
ZBTB7A ENSG00000178951 C2H2 ZF Known motif – High-throughput in vitro [1,057] RCGACCACCNV
ZBTB7B ENSG00000160685 C2H2 ZF Known motif – High-throughput in vitro [1,058] DCGACCMCCVA
ZBTB7C ENSG00000184828 C2H2 ZF Known motif – High-throughput in vitro [1,059] DCRACCACCVH
ZBTB8A ENSG00000160062 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,060]
ZBTB8B ENSG00000273274 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,061]
ZBTB9 ENSG00000213588 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,062]
ZC3H8 ENSG00000144161 CCCH ZF Likely sequence specific TF according to literature or domain structure – No motif [1,063]
ZEB1 ENSG00000148516 C2H2 ZF; Homeodomain Known motif – In vivo/Misc source [1,064] CAGGTGNR
ZEB2 ENSG00000169554 C2H2 ZF; Homeodomain Inferred motif from similar protein – In vivo/Misc source [1,065] CAGGTGNR
ZFAT ENSG00000066827 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,066]
ZFHX2 ENSG00000136367 Homeodomain Known motif – High-throughput in vitro [1,067] TRATYA
ZFHX3 ENSG00000140836 C2H2 ZF; Homeodomain Known motif – High-throughput in vitro [1,068] RMTND
ZFHX4 ENSG00000091656 C2H2 ZF; Homeodomain Inferred motif from similar protein – In vivo/Misc source [1,069] WAATWAWTAAY
ZFP1 ENSG00000184517 C2H2 ZF Known motif – High-throughput in vitro [1,070] TDYBATACCCANHH
ZFP14 ENSG00000142065 C2H2 ZF Known motif – High-throughput in vitro [1,071] GGAGSHHHHDGARHK
ZFP2 ENSG00000198939 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,072] RGRAAVYGAAACT
ZFP28 ENSG00000196867 C2H2 ZF Known motif – High-throughput in vitro [1,073] AYMNHWRARGAAAHDGARMKVHHDNDNNDNNH
ZFP3 ENSG00000180787 C2H2 ZF Known motif – High-throughput in vitro [1,074] GGNTGNRTAGGAGYTYDB
ZFP30 ENSG00000120784 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,075] RAHRNRGYTRNRDRNRG
ZFP37 ENSG00000136866 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,076]
ZFP41 ENSG00000181638 C2H2 ZF Known motif – High-throughput in vitro [1,077] RYGGAGAGTTAGC
ZFP42 ENSG00000179059 C2H2 ZF Known motif – High-throughput in vitro [1,078] CAAKATGGCBGHC
ZFP57 ENSG00000204644 C2H2 ZF Known motif – In vivo/Misc source [1,079] SNNVNNVBTGCCGCV
ZFP62 ENSG00000196670 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,080]
ZFP64 ENSG00000020256 C2H2 ZF Known motif – In vivo/Misc source [1,081] VGGRSCCCGGGVVNS
ZFP69 ENSG00000187815 C2H2 ZF Known motif – High-throughput in vitro [1,082] GWGRCTRGAWAC
ZFP69B ENSG00000187801 C2H2 ZF Known motif – High-throughput in vitro [1,083] GTGGCTGGARVV
ZFP82 ENSG00000181007 C2H2 ZF Known motif – High-throughput in vitro [1,084] AGAATTAGTRAAYTGGAARAY
ZFP90 ENSG00000184939 C2H2 ZF Known motif – High-throughput in vitro [1,085] RYACTGCTTTWG
ZFP91 ENSG00000186660 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,086]
ZFP92 ENSG00000189420 C2H2 ZF Known motif – In vivo/Misc source [1,087] MGATAAAAKGM
ZFPM1 ENSG00000179588 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,088]
ZFPM2 ENSG00000169946 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,089]
ZFX ENSG00000005889 C2H2 ZF Known motif – In vivo/Misc source [1,090] VVSVSBNBBAGGCCBVGSH
ZFY ENSG00000067646 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,091] BAGGCCBVGSYBVV
ZGLP1 ENSG00000220201 GATA Likely sequence specific TF according to literature or domain structure – No motif [1,092]
ZGPAT ENSG00000197114 CCCH ZF Likely sequence specific TF according to literature or domain structure – No motif [1,093]
ZHX1 ENSG00000165156 Homeodomain Known motif – High-throughput in vitro [1,094] DYB
ZHX2 ENSG00000178764 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [1,095]
ZHX3 ENSG00000174306 Homeodomain Likely sequence specific TF according to literature or domain structure – No motif [1,096]
ZIC1 ENSG00000152977 C2H2 ZF Known motif – High-throughput in vitro [1,097] DCRCAGCRGGGGGBV
ZIC2 ENSG00000043355 C2H2 ZF Known motif – from protein with 100% identical DBD – in vitro [1,098] YNRBRKG
ZIC3 ENSG00000156925 C2H2 ZF Known motif – High-throughput in vitro [1,099] KCACAGCRGGGGGTCB
ZIC4 ENSG00000174963 C2H2 ZF Known motif – High-throughput in vitro [1,100] DCNCHRCRGGGGGYM
ZIC5 ENSG00000139800 C2H2 ZF Known motif – High-throughput in vitro [1,101] DCDCAGCGGGGGGTM
ZIK1 ENSG00000171649 C2H2 ZF Known motif – High-throughput in vitro [1,102] RDRRCAAWRGCAMNRVRWNNB
ZIM2 ENSG00000269699 C2H2 ZF Known motif – In vivo/Misc source [1,103] YCNBSYBSCYTYYYCHBCCVGCCYGKGGYY
ZIM3 ENSG00000141946 C2H2 ZF Known motif – High-throughput in vitro [1,104] RNHAACAGAAANCYM
ZKSCAN1 ENSG00000106261 C2H2 ZF Known motif – High-throughput in vitro [1,105] CCTACTAHGH
ZKSCAN2 ENSG00000155592 C2H2 ZF Known motif – High-throughput in vitro [1,106] RRRRRMMAC
ZKSCAN3 ENSG00000189298 C2H2 ZF Known motif – High-throughput in vitro [1,107] TCGAGGYTAGMCCA
ZKSCAN4 ENSG00000187626 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,108]
ZKSCAN5 ENSG00000196652 C2H2 ZF Known motif – High-throughput in vitro [1,109] DGGAGGTGA
ZKSCAN7 ENSG00000196345 C2H2 ZF Known motif – High-throughput in vitro [1,110] VYAHACTKTNRAGYGV
ZKSCAN8 ENSG00000198315 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,111]
ZMAT1 ENSG00000166432 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,112]
ZMAT4 ENSG00000165061 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,113]
ZNF10 ENSG00000256223 C2H2 ZF Known motif – High-throughput in vitro [1,114] TGAGGT
ZNF100 ENSG00000197020 C2H2 ZF Known motif – High-throughput in vitro [1,115] VBRNGGCGGCGGCNB
ZNF101 ENSG00000181896 C2H2 ZF Known motif – High-throughput in vitro [1,116] VDGYKGCCCCHGTRTCH
ZNF107 ENSG00000196247 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,117]
ZNF112 ENSG00000062370 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,118]
ZNF114 ENSG00000178150 C2H2 ZF Known motif – In vivo/Misc source [1,119] VSSSBSBVVSSBSSSSYHTWTATABVSB
ZNF117 ENSG00000152926 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,120] GKGCWGCAGM
ZNF12 ENSG00000164631 C2H2 ZF Known motif – High-throughput in vitro [1,121] VYGCKRTAACAARYAKSMCC
ZNF121 ENSG00000197961 C2H2 ZF Known motif – High-throughput in vitro [1,122] VCDGGVCMRVDBWGYVNGRYCCH
ZNF124 ENSG00000196418 C2H2 ZF Known motif – High-throughput in vitro [1,123] AAGAAGGCTTTAATYRGG
ZNF131 ENSG00000172262 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,124]
ZNF132 ENSG00000131849 C2H2 ZF Known motif – High-throughput in vitro [1,125] VRGGARRGNRGGARG
ZNF133 ENSG00000125846 C2H2 ZF Known motif – High-throughput in vitro [1,126] DGRNMCAAMWNANGTAHAAKTGGHDNH
ZNF134 ENSG00000213762 C2H2 ZF Known motif – High-throughput in vitro [1,127] VYTMAKCAGKKGMNG
ZNF135 ENSG00000176293 C2H2 ZF Known motif – High-throughput in vitro [1,128] HHYTGAGGTYGAGCY
ZNF136 ENSG00000196646 C2H2 ZF Known motif – High-throughput in vitro [1,129] TTCTTGGTTGRCAGKTTT
ZNF138 ENSG00000197008 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,130]
ZNF14 ENSG00000105708 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,131]
ZNF140 ENSG00000196387 C2H2 ZF Known motif – High-throughput in vitro [1,132] GAGCGGAATTGYH
ZNF141 ENSG00000131127 C2H2 ZF Known motif – High-throughput in vitro [1,133] RVKGRGRGYGKCCCCC
ZNF142 ENSG00000115568 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,134]
ZNF143 ENSG00000166478 C2H2 ZF Known motif – High-throughput in vitro [1,135] YWCCCAYAATGCAYYG
ZNF146 ENSG00000167635 C2H2 ZF Known motif – High-throughput in vitro [1,136] GGARTAYTABDCAGC
ZNF148 ENSG00000163848 C2H2 ZF Known motif – In vivo/Misc source [1,137] DGKGGGRGGD
ZNF154 ENSG00000179909 C2H2 ZF Known motif – High-throughput in vitro [1,138] TGTCTAGTARRTCYD
ZNF155 ENSG00000204920 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,139]
ZNF157 ENSG00000147117 C2H2 ZF Known motif – High-throughput in vitro [1,140] KNNDNGYRYAYTGHWDNCCYYVCCADGHCH
ZNF16 ENSG00000170631 C2H2 ZF Known motif – High-throughput in vitro [1,141] GAGCCAYDGMRGGYKBTD
ZNF160 ENSG00000170949 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,142]
ZNF165 ENSG00000197279 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,143]
ZNF169 ENSG00000175787 C2H2 ZF Known motif – High-throughput in vitro [1,144] CTCCCT
ZNF17 ENSG00000186272 C2H2 ZF Known motif – High-throughput in vitro [1,145] VNBNNNNNSTKYMTGYTCHKGNNNV
ZNF174 ENSG00000103343 C2H2 ZF Known motif – High-throughput in vitro [1,146] GSCRAGTGAYYGNC
ZNF175 ENSG00000105497 C2H2 ZF Known motif – In vivo/Misc source [1,147] CYAYACAHRAYAADGAATACA
ZNF177 ENSG00000188629 C2H2 ZF Known motif – High-throughput in vitro [1,148] BTYGRTCKMRNKKNNVAGTCATD
ZNF18 ENSG00000154957 C2H2 ZF Known motif – High-throughput in vitro [1,149] SNRTTCACACY
ZNF180 ENSG00000167384 C2H2 ZF Known motif – High-throughput in vitro [1,150] VGGGVSNGGNGGSGRSBGSGGCVV
ZNF181 ENSG00000197841 C2H2 ZF Known motif – High-throughput in vitro [1,151] VYYYSWGSTWSTNGGRMKGMKGHB
ZNF182 ENSG00000147118 C2H2 ZF Known motif – High-throughput in vitro [1,152] AAAAMMAAAARMAAA
ZNF184 ENSG00000096654 C2H2 ZF Known motif – High-throughput in vitro [1,153] TGGWGARGA
ZNF189 ENSG00000136870 C2H2 ZF Known motif – High-throughput in vitro [1,154] VDGGAASRGMVDNDS
ZNF19 ENSG00000157429 C2H2 ZF Known motif – High-throughput in vitro [1,155] DRGGVBHHDGACRNNDV
ZNF195 ENSG00000005801 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,156]
ZNF197 ENSG00000186448 C2H2 ZF Known motif – High-throughput in vitro [1,157] RRRGWCARRRRVVVR
ZNF2 ENSG00000275111 C2H2 ZF Known motif – High-throughput in vitro [1,158] SCVCVGVGCYGCGC
ZNF20 ENSG00000132010 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,159]
ZNF200 ENSG00000010539 C2H2 ZF Known motif – High-throughput in vitro [1,160] BVNVSCGGAAGY
ZNF202 ENSG00000166261 C2H2 ZF Known motif – In vivo/Misc source [1,161] CSCNBCYYCCDCYBCYBSBBCSBSBSCYB
ZNF205 ENSG00000122386 C2H2 ZF Known motif – In vivo/Misc source [1,162] TGGAAT
ZNF207 ENSG00000010244 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,163]
ZNF208 ENSG00000160321 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,164]
ZNF211 ENSG00000121417 C2H2 ZF Known motif – High-throughput in vitro [1,165] HNYATATACCAB
ZNF212 ENSG00000170260 C2H2 ZF Known motif – In vivo/Misc source [1,166] CACACAHVHMCACRC
ZNF213 ENSG00000085644 C2H2 ZF Known motif – High-throughput in vitro [1,167] MGAMMBCRGGCGGMG
ZNF214 ENSG00000149050 C2H2 ZF Known motif – High-throughput in vitro [1,168] VWTMATYAANRTCCTCAAVAABD
ZNF215 ENSG00000149054 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,169]
ZNF217 ENSG00000171940 C2H2 ZF Known motif – In vivo/Misc source [1,170] GKNRGAAT
ZNF219 ENSG00000165804 C2H2 ZF Known motif – In vivo/Misc source [1,171] DGGGGGGYGGW
ZNF22 ENSG00000165512 C2H2 ZF Known motif – High-throughput in vitro [1,172] AAAAAAAAA
ZNF221 ENSG00000159905 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,173]
ZNF222 ENSG00000159885 C2H2 ZF Known motif – High-throughput in vitro [1,174] GCTGMSAYB
ZNF223 ENSG00000178386 C2H2 ZF Known motif – In vivo/Misc source [1,175] MCACACASASM
ZNF224 ENSG00000267680 C2H2 ZF Known motif – High-throughput in vitro [1,176] WMCYYNKGDGYHMHRKGRMTY
ZNF225 ENSG00000256294 C2H2 ZF Known motif – In vivo/Misc source [1,177] TTAYCWKYDKNRYTTYTTTYTTTTTYYH
ZNF226 ENSG00000167380 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,178]
ZNF227 ENSG00000131115 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,179]
ZNF229 ENSG00000278318 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,180]
ZNF23 ENSG00000167377 C2H2 ZF Known motif – High-throughput in vitro [1,181] DCRMCCATGGCCGCGHCM
ZNF230 ENSG00000159882 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,182]
ZNF232 ENSG00000167840 C2H2 ZF Known motif – High-throughput in vitro [1,183] RTGTTAAAYGTRGATTAAS
ZNF233 ENSG00000159915 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,184]
ZNF234 ENSG00000263002 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,185]
ZNF235 ENSG00000159917 C2H2 ZF Known motif – High-throughput in vitro [1,186] AARARADRAARRAAAWNRDDWDVDNNAWDR
ZNF236 ENSG00000130856 C2H2 ZF Known motif – In vivo/Misc source [1,187] MGTAATATTVM
ZNF239 ENSG00000196793 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,188]
ZNF24 ENSG00000172466 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,189]
ZNF248 ENSG00000198105 C2H2 ZF Known motif – High-throughput in vitro [1,190] RHDDACHATRTYCAKBRA
ZNF25 ENSG00000175395 C2H2 ZF Known motif – In vivo/Misc source [1,191] WGAADWANAVARGTYGCWGCATTTAGAAA
ZNF250 ENSG00000196150 C2H2 ZF Known motif – High-throughput in vitro [1,192] YASGCCYAY
ZNF251 ENSG00000198169 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,193]
ZNF253 ENSG00000256771 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,194]
ZNF254 ENSG00000213096 C2H2 ZF Known motif – High-throughput in vitro [1,195] ACTGGCYTAGCCTCCCAGCCTACATCTTTCTCC
ZNF256 ENSG00000152454 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,196]
ZNF257 ENSG00000197134 C2H2 ZF Known motif – High-throughput in vitro [1,197] GAGGMRA
ZNF26 ENSG00000198393 C2H2 ZF Known motif – In vivo/Misc source [1,198] ATTTTT
ZNF260 ENSG00000254004 C2H2 ZF Known motif – High-throughput in vitro [1,199] GGARDRVDANRVDRV
ZNF263 ENSG00000006194 C2H2 ZF Known motif – High-throughput in vitro [1,200] GGGAGSACB
ZNF264 ENSG00000083844 C2H2 ZF Known motif – High-throughput in vitro [1,201] KKGRGSCCYYHNBRATGGGATTAGTGCCCT
ZNF266 ENSG00000174652 C2H2 ZF Known motif – High-throughput in vitro [1,202] VNHRCTCACAGSYCC
ZNF267 ENSG00000185947 C2H2 ZF Known motif – High-throughput in vitro [1,203] VSYNVVGGCNKGBGVRGVDG
ZNF268 ENSG00000090612 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,204]
ZNF273 ENSG00000198039 C2H2 ZF Known motif – High-throughput in vitro [1,205] GARAGGAGCTAC
ZNF274 ENSG00000171606 C2H2 ZF Known motif – High-throughput in vitro [1,206] VYGAGRACTCAYRY
ZNF275 ENSG00000063587 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,207]
ZNF276 ENSG00000158805 C2H2 ZF Known motif – High-throughput in vitro [1,208] WAAGGWSGWVDMKACNHCCTTWA
ZNF277 ENSG00000198839 C2H2 ZF; BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,209]
ZNF28 ENSG00000198538 C2H2 ZF Known motif – High-throughput in vitro [1,210] GBNKSHGGGGTGCCM
ZNF280A ENSG00000169548 C2H2 ZF Known motif – In vivo/Misc source [1,211] TCTCWCCWGTRTGRRTTCTYTSAT
ZNF280B ENSG00000275004 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,212]
ZNF280C ENSG00000056277 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,213]
ZNF280D ENSG00000137871 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,214]
ZNF281 ENSG00000162702 C2H2 ZF Known motif – High-throughput in vitro [1,215] KGGGGGAGGGGS
ZNF282 ENSG00000170265 C2H2 ZF Known motif – High-throughput in vitro [1,216] HTCCCMYNACMCK
ZNF283 ENSG00000167637 C2H2 ZF Known motif – High-throughput in vitro [1,217] BNGGCTGRTSBKGSYBGGSYB
ZNF284 ENSG00000186026 C2H2 ZF Known motif – High-throughput in vitro [1,218] GCTGGAGTGCAG
ZNF285 ENSG00000267508 C2H2 ZF Known motif – In vivo/Misc source [1,219] TNTTYTYBYTYDYTYTNHTTT
ZNF286A ENSG00000187607 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,220]
ZNF286B ENSG00000249459 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,221]
ZNF287 ENSG00000141040 C2H2 ZF Known motif – High-throughput in vitro [1,222] AAAARAAAARRWARMARAVMWRRARRAVADR
ZNF292 ENSG00000188994 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,223]
ZNF296 ENSG00000170684 C2H2 ZF Known motif – High-throughput in vitro [1,224] VVTGWCCASYV
ZNF3 ENSG00000166526 C2H2 ZF Known motif – High-throughput in vitro [1,225] TGAHTGAMTRANWGA
ZNF30 ENSG00000168661 C2H2 ZF Known motif – High-throughput in vitro [1,226] CGGACGGGGCGGCTG
ZNF300 ENSG00000145908 C2H2 ZF Known motif – In vivo/Misc source [1,227] KKDGWRDDDGNRKBNDDGDDKKNRNBKRKR
ZNF302 ENSG00000089335 C2H2 ZF Known motif – High-throughput in vitro [1,228] AGTTGAGTGACTGYDSTT
ZNF304 ENSG00000131845 C2H2 ZF Known motif – High-throughput in vitro [1,229] VVGRSYVGRBYGGGGMVGGNV
ZNF311 ENSG00000197935 C2H2 ZF Known motif – In vivo/Misc source [1,230] YYSCDGCBSBNBCYS
ZNF316 ENSG00000205903 C2H2 ZF Known motif – In vivo/Misc source [1,231] KCCSCCGGACCH
ZNF317 ENSG00000130803 C2H2 ZF Known motif – High-throughput in vitro [1,232] RACAGMWGACWD
ZNF318 ENSG00000171467 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,233]
ZNF319 ENSG00000166188 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,234]
ZNF32 ENSG00000169740 C2H2 ZF Known motif – High-throughput in vitro [1,235] BGTAAYNYGAYACB
ZNF320 ENSG00000182986 C2H2 ZF Known motif – High-throughput in vitro [1,236] CMYHKKCCCCYKGVHCCCMC
ZNF322 ENSG00000181315 C2H2 ZF Known motif – High-throughput in vitro [1,237] VVGGCHSHGKASCAGDCHS
ZNF324 ENSG00000083812 C2H2 ZF Known motif – High-throughput in vitro [1,238] GRTYRAACCATCCY
ZNF324B ENSG00000249471 C2H2 ZF Known motif – In vivo/Misc source [1,239] HHHDGSMRGSHRAGG
ZNF326 ENSG00000162664 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,240]
ZNF329 ENSG00000181894 C2H2 ZF Known motif – High-throughput in vitro [1,241] CYKGAKCMVVCYNNDCCTGMA
ZNF331 ENSG00000130844 C2H2 ZF Known motif – High-throughput in vitro [1,242] VVAVSSNNMYWGCWGAGCMCWKYCH
ZNF333 ENSG00000160961 C2H2 ZF Known motif – High-throughput in vitro [1,243] STGGAKSM
ZNF334 ENSG00000198185 C2H2 ZF Known motif – In vivo/Misc source [1,244] YCCGKSMGGGAGGTGRGG
ZNF335 ENSG00000198026 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,245]
ZNF337 ENSG00000130684 C2H2 ZF Known motif – High-throughput in vitro [1,246] AGTRGTGAYRAATTC
ZNF33A ENSG00000189180 C2H2 ZF Known motif – High-throughput in vitro [1,247] TCAGTGCAC
ZNF33B ENSG00000196693 C2H2 ZF Known motif – High-throughput in vitro [1,248] ATTMAATHCCHTYYNHTDVMW
ZNF34 ENSG00000196378 C2H2 ZF Known motif – In vivo/Misc source [1,249] DRARGAVAAGYCTGD
ZNF341 ENSG00000131061 C2H2 ZF Known motif – In vivo/Misc source [1,250] VVVRRVRRNDVVNGGARSAGC
ZNF343 ENSG00000088876 C2H2 ZF Known motif – High-throughput in vitro [1,251] KRCCGHGGKGAAGCGB
ZNF345 ENSG00000251247 C2H2 ZF Known motif – High-throughput in vitro [1,252] TTGCAACVYVNRCAACYGKAC
ZNF346 ENSG00000113761 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,253]
ZNF347 ENSG00000197937 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,254]
ZNF35 ENSG00000169981 C2H2 ZF Known motif – High-throughput in vitro [1,255] ATATRTAAAGAGYTYYTABAA
ZNF350 ENSG00000256683 C2H2 ZF Known motif – High-throughput in vitro [1,256] DNBDVRKHAWAAAARRRCH
ZNF354A ENSG00000169131 C2H2 ZF Known motif – High-throughput in vitro [1,257] RTAAATGGHYTAAAY
ZNF354B ENSG00000178338 C2H2 ZF Known motif – High-throughput in vitro [1,258] AAKGRRMTAWHY
ZNF354C ENSG00000177932 C2H2 ZF Known motif – In vivo/Misc source [1,259] VTCCAC
ZNF358 ENSG00000198816 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,260]
ZNF362 ENSG00000160094 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,261]
ZNF365 ENSG00000138311 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,262]
ZNF366 ENSG00000178175 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,263]
ZNF367 ENSG00000165244 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,264]
ZNF37A ENSG00000075407 C2H2 ZF Known motif – High-throughput in vitro [1,265] GGARRRRRV
ZNF382 ENSG00000161298 C2H2 ZF Known motif – High-throughput in vitro [1,266] GWGVMANYASTACAGRYMHHRBDS
ZNF383 ENSG00000188283 C2H2 ZF Known motif – High-throughput in vitro [1,267] GAGSVRVRASRKGGMAGGRRBCNGGGY
ZNF384 ENSG00000126746 C2H2 ZF Known motif – High-throughput in vitro [1,268] TTTTBNNNNNNNNNNNNVAAAA
ZNF385A ENSG00000161642 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,269]
ZNF385B ENSG00000144331 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,270]
ZNF385C ENSG00000187595 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,271]
ZNF385D ENSG00000151789 C2H2 ZF Known motif – High-throughput in vitro [1,272] HHGTCGCGACRD
ZNF391 ENSG00000124613 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,273]
ZNF394 ENSG00000160908 C2H2 ZF Known motif – In vivo/Misc source [1,274] VVRGGAGNAGCWGNRVVDNV
ZNF395 ENSG00000186918 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,275]
ZNF396 ENSG00000186496 C2H2 ZF Known motif – High-throughput in vitro [1,276] VTTTCGKACAB
ZNF397 ENSG00000186812 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,277]
ZNF398 ENSG00000197024 C2H2 ZF Known motif – In vivo/Misc source [1,278] DGGGARRGARRSAG
ZNF404 ENSG00000176222 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,279]
ZNF407 ENSG00000215421 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,280]
ZNF408 ENSG00000175213 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,281]
ZNF41 ENSG00000147124 C2H2 ZF Known motif – High-throughput in vitro [1,282] RMARGGRARNNNRRSACMATGAGNVAV
ZNF410 ENSG00000119725 C2H2 ZF Known motif – High-throughput in vitro [1,283] MCATCCCATAATANBM
ZNF414 ENSG00000133250 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,284]
ZNF415 ENSG00000170954 C2H2 ZF Known motif – In vivo/Misc source [1,285] VTRCVCVMTKARBATC
ZNF416 ENSG00000083817 C2H2 ZF Known motif – In vivo/Misc source [1,286] TRGCCCAGTCAAGTTGAC
ZNF417 ENSG00000173480 C2H2 ZF Known motif – High-throughput in vitro [1,287] HNGGCGCCAVNTG
ZNF418 ENSG00000196724 C2H2 ZF Known motif – High-throughput in vitro [1,288] VDGWRGCYAAAAGCA
ZNF419 ENSG00000105136 C2H2 ZF Known motif – High-throughput in vitro [1,289] DGGARAGKMHAGGRCTGBADW
ZNF420 ENSG00000197050 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,290]
ZNF423 ENSG00000102935 C2H2 ZF Known motif – In vivo/Misc source [1,291] GRCACCCWAGGGTGC
ZNF425 ENSG00000204947 C2H2 ZF Known motif – In vivo/Misc source [1,292] GGBACA
ZNF426 ENSG00000130818 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,293]
ZNF428 ENSG00000131116 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,294]
ZNF429 ENSG00000197013 C2H2 ZF Known motif – High-throughput in vitro [1,295] DGGMRKAGSHVNMAATGGGYH
ZNF43 ENSG00000198521 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,296]
ZNF430 ENSG00000118620 C2H2 ZF Known motif – High-throughput in vitro [1,297] MCADGGHRGMNDGCHR
ZNF431 ENSG00000196705 C2H2 ZF Known motif – In vivo/Misc source [1,298] VRGGCTRGMWGNYNV
ZNF432 ENSG00000256087 C2H2 ZF Known motif – In vivo/Misc source [1,299] GTYRAAAACAAT
ZNF433 ENSG00000197647 C2H2 ZF Known motif – High-throughput in vitro [1,300] RDGACYRHWGTRRTAAYY
ZNF436 ENSG00000125945 C2H2 ZF Known motif – High-throughput in vitro [1,301] TCCTCCAGGAAGCCY
ZNF438 ENSG00000183621 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,302]
ZNF439 ENSG00000171291 C2H2 ZF Known motif – In vivo/Misc source [1,303] CARTCACCYYCHGGV
ZNF44 ENSG00000197857 C2H2 ZF Known motif – High-throughput in vitro [1,304] VBGNTVYKGCHGYDVNG
ZNF440 ENSG00000171295 C2H2 ZF Known motif – High-throughput in vitro [1,305] RRTKGTTCTGCW
ZNF441 ENSG00000197044 C2H2 ZF Known motif – High-throughput in vitro [1,306] SRGRCGGAGYB
ZNF442 ENSG00000198342 C2H2 ZF Known motif – In vivo/Misc source [1,307] SHWDWTWTTTNHHTTTTT
ZNF443 ENSG00000180855 C2H2 ZF Known motif – High-throughput in vitro [1,308] GYCTBCYMAGWHGCKGGBRTT
ZNF444 ENSG00000167685 C2H2 ZF Known motif – High-throughput in vitro [1,309] DGGGGGAGGGGGAYG
ZNF445 ENSG00000185219 C2H2 ZF Known motif – In vivo/Misc source [1,310] AAMTYCYYGASNRNMMAGGRKTMYYYCHC
ZNF446 ENSG00000083838 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,311]
ZNF449 ENSG00000173275 C2H2 ZF Known motif – High-throughput in vitro [1,312] RCGCCCAACC
ZNF45 ENSG00000124459 C2H2 ZF Known motif – High-throughput in vitro [1,313] AGGAANAYA
ZNF451 ENSG00000112200 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,314]
ZNF454 ENSG00000178187 C2H2 ZF Known motif – High-throughput in vitro [1,315] WRGCGCCWGGCGCYW
ZNF460 ENSG00000197714 C2H2 ZF Known motif – High-throughput in vitro [1,316] CAACGCCCCCCG
ZNF461 ENSG00000197808 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,317]
ZNF462 ENSG00000148143 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,318]
ZNF467 ENSG00000181444 C2H2 ZF Known motif – High-throughput in vitro [1,319] GGDGGGGGAGGG
ZNF468 ENSG00000204604 C2H2 ZF Known motif – High-throughput in vitro [1,320] DGGGAGGGGGYGSNS
ZNF469 ENSG00000225614 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,321]
ZNF470 ENSG00000197016 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,322]
ZNF471 ENSG00000196263 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,323]
ZNF473 ENSG00000142528 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,324]
ZNF474 ENSG00000164185 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,325]
ZNF479 ENSG00000185177 C2H2 ZF Known motif – High-throughput in vitro [1,326] GADGACYYKGRGGRY
ZNF48 ENSG00000180035 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,327]
ZNF480 ENSG00000198464 C2H2 ZF Known motif – High-throughput in vitro [1,328] DRDGAAKGDGDD
ZNF483 ENSG00000173258 C2H2 ZF Known motif – High-throughput in vitro [1,329] DSAGRGAGCTGCA
ZNF484 ENSG00000127081 C2H2 ZF Known motif – High-throughput in vitro [1,330] VRDGGAVWGVRGMASWDGVNV
ZNF485 ENSG00000198298 C2H2 ZF Known motif – High-throughput in vitro [1,331] AYTTSSWWTKKSRMYRTRKGS
ZNF486 ENSG00000256229 C2H2 ZF Known motif – In vivo/Misc source [1,332] VVBBBNSNGCSGAMDCCCGGV
ZNF487 ENSG00000243660 C2H2 ZF Known motif – In vivo/Misc source [1,333] VVBBBNSNGCSGAMDCCCGGV
ZNF488 ENSG00000265763 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,334]
ZNF490 ENSG00000188033 C2H2 ZF Known motif – In vivo/Misc source [1,335] HDGNMRGCAGCANAY
ZNF491 ENSG00000177599 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,336]
ZNF492 ENSG00000229676 C2H2 ZF Known motif – High-throughput in vitro [1,337] MNAARARMAMBAAAARGG
ZNF493 ENSG00000196268 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,338]
ZNF496 ENSG00000162714 C2H2 ZF Known motif – In vivo/Misc source [1,339] BCNSBCYCYBHMYYHSHBYCY
ZNF497 ENSG00000174586 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,340]
ZNF500 ENSG00000103199 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,341]
ZNF501 ENSG00000186446 C2H2 ZF Known motif – High-throughput in vitro [1,342] GCGACGCGAMCV
ZNF502 ENSG00000196653 C2H2 ZF Known motif – High-throughput in vitro [1,343] GGACYDBTGCAGTAGYHH
ZNF503 ENSG00000165655 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,344]
ZNF506 ENSG00000081665 C2H2 ZF Known motif – High-throughput in vitro [1,345] YTGGGGGCTCVBMC
ZNF507 ENSG00000168813 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,346]
ZNF510 ENSG00000081386 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,347]
ZNF511 ENSG00000198546 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,348]
ZNF512 ENSG00000243943 C2H2 ZF; BED ZF Likely sequence specific TF according to literature or domain structure – No motif [1,349]
ZNF512B ENSG00000196700 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,350]
ZNF513 ENSG00000163795 C2H2 ZF Known motif – High-throughput in vitro [1,351] GATGRTGATGATGRT
ZNF514 ENSG00000144026 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,352]
ZNF516 ENSG00000101493 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,353]
ZNF517 ENSG00000197363 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,354]
ZNF518A ENSG00000177853 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,355]
ZNF518B ENSG00000178163 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,356]
ZNF519 ENSG00000175322 C2H2 ZF Known motif – High-throughput in vitro [1,357] GGGCGGCKGCRGCBGCGS
ZNF521 ENSG00000198795 C2H2 ZF Known motif – In vivo/Misc source [1,358] TGGGGGMCCCCW
ZNF524 ENSG00000171443 C2H2 ZF; AT hook Known motif – High-throughput in vitro [1,359] YTCGVACCC
ZNF525 ENSG00000203326 C2H2 ZF Known motif – High-throughput in vitro [1,360] RTTMCTWATDMAGNT
ZNF526 ENSG00000167625 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,361]
ZNF527 ENSG00000189164 C2H2 ZF Known motif – In vivo/Misc source [1,362] DGRKNGBMDGHRACAGMRR
ZNF528 ENSG00000167555 C2H2 ZF Known motif – High-throughput in vitro [1,363] GGAAGYCATTTC
ZNF529 ENSG00000186020 C2H2 ZF Known motif – In vivo/Misc source [1,364] CYCYBYCTBCYHDSM
ZNF530 ENSG00000183647 C2H2 ZF Known motif – High-throughput in vitro [1,365] GMADGGMNAGGGSCNGVV
ZNF532 ENSG00000074657 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,366]
ZNF534 ENSG00000198633 C2H2 ZF Known motif – High-throughput in vitro [1,367] GVGGGGMRAGARBNBVV
ZNF536 ENSG00000198597 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,368]
ZNF540 ENSG00000171817 C2H2 ZF Known motif – In vivo/Misc source [1,369] RGRGGVAGGVA
ZNF541 ENSG00000118156 C2H2 ZF; Myb/SANT Known motif – In vivo/Misc source [1,370] CCCATGCGCGGG
ZNF543 ENSG00000178229 C2H2 ZF Known motif – High-throughput in vitro [1,371] SSVCWGGVCMGS
ZNF544 ENSG00000198131 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,372]
ZNF546 ENSG00000187187 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,373]
ZNF547 ENSG00000152433 C2H2 ZF Known motif – High-throughput in vitro [1,374] GCWAAYKCWGCARGC
ZNF548 ENSG00000188785 C2H2 ZF Known motif – High-throughput in vitro [1,375] GBBGCKGCDGSVSSVSVG
ZNF549 ENSG00000121406 C2H2 ZF Known motif – High-throughput in vitro [1,376] ATGAAYYGGGCAGCM
ZNF550 ENSG00000251369 C2H2 ZF Known motif – High-throughput in vitro [1,377] DNVRRDGCWRRGGYAGRG
ZNF551 ENSG00000204519 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,378]
ZNF552 ENSG00000178935 C2H2 ZF Known motif – High-throughput in vitro [1,379] CCACGAGGGGH
ZNF554 ENSG00000172006 C2H2 ZF Known motif – High-throughput in vitro [1,380] CHGRGYCANNYRGDKDRCH
ZNF555 ENSG00000186300 C2H2 ZF Known motif – In vivo/Misc source [1,381] AAAAAGCCGCGGCGG
ZNF556 ENSG00000172000 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,382]
ZNF557 ENSG00000130544 C2H2 ZF Known motif – In vivo/Misc source [1,383] MAGARTGYT
ZNF558 ENSG00000167785 C2H2 ZF Known motif – High-throughput in vitro [1,384] HKGRAYHTGTRGRTKBATRYCTTYCAK
ZNF559 ENSG00000188321 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,385]
ZNF560 ENSG00000198028 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,386]
ZNF561 ENSG00000171469 C2H2 ZF Known motif – In vivo/Misc source [1,387] DSNGCMGAAARGSBBYBBBCC
ZNF562 ENSG00000171466 C2H2 ZF Known motif – In vivo/Misc source [1,388] DDYYCAGCAAGGCAMWWT
ZNF563 ENSG00000188868 C2H2 ZF Known motif – High-throughput in vitro [1,389] BTCMBNNSHRGCMRCHGY
ZNF564 ENSG00000249709 C2H2 ZF Known motif – High-throughput in vitro [1,390] GGGAAGTCCAAG
ZNF565 ENSG00000196357 C2H2 ZF Known motif – High-throughput in vitro [1,391] ATGYTGTGAGGAAGCYCA
ZNF566 ENSG00000186017 C2H2 ZF Known motif – High-throughput in vitro [1,392] VNDGCKGVAARGGARSC
ZNF567 ENSG00000189042 C2H2 ZF Known motif – High-throughput in vitro [1,393] VHAVAARHAGAMMHHNARRTG
ZNF568 ENSG00000198453 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,394]
ZNF569 ENSG00000196437 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,395]
ZNF57 ENSG00000171970 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,396]
ZNF570 ENSG00000171827 C2H2 ZF Known motif – High-throughput in vitro [1,397] ARAHAWMWHNMAAGAAAA
ZNF571 ENSG00000180479 C2H2 ZF Known motif – High-throughput in vitro [1,398] SSGMGGCBGMGGCRG
ZNF572 ENSG00000180938 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,399]
ZNF573 ENSG00000189144 C2H2 ZF Known motif – High-throughput in vitro [1,400] MAGHMMDGGCMCAMNMADB
ZNF574 ENSG00000105732 C2H2 ZF Known motif – High-throughput in vitro [1,401] CTAGAGMGKCSS
ZNF575 ENSG00000176472 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,402]
ZNF576 ENSG00000124444 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,403]
ZNF577 ENSG00000161551 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,404]
ZNF578 ENSG00000258405 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,405]
ZNF579 ENSG00000218891 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,406]
ZNF580 ENSG00000213015 C2H2 ZF Known motif – High-throughput in vitro [1,407] VCTACCNYHNNVCTACCNH
ZNF581 ENSG00000171425 C2H2 ZF Known motif – In vivo/Misc source [1,408] CTTCTAVAAGV
ZNF582 ENSG00000018869 C2H2 ZF Known motif – High-throughput in vitro [1,409] KYMSYTGCMGCCNARNGCAYBCYH
ZNF583 ENSG00000198440 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,410]
ZNF584 ENSG00000171574 C2H2 ZF Known motif – High-throughput in vitro [1,411] DNTTTMARAAHTGYTWTGGDH
ZNF585A ENSG00000196967 C2H2 ZF Known motif – High-throughput in vitro [1,412] TCYGTWYTY
ZNF585B ENSG00000245680 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,413]
ZNF586 ENSG00000083828 C2H2 ZF Known motif – High-throughput in vitro [1,414] CAGGCCYRGAGG
ZNF587 ENSG00000198466 C2H2 ZF Known motif – High-throughput in vitro [1,415] MCMRYGTTGGGCGCHANNHD
ZNF587B ENSG00000269343 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,416]
ZNF589 ENSG00000164048 C2H2 ZF Known motif – In vivo/Misc source [1,417] VSRBDRWWVCCBYKK
ZNF592 ENSG00000166716 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,418]
ZNF594 ENSG00000180626 C2H2 ZF Known motif – High-throughput in vitro [1,419] RDDSDGAGAGCNSS
ZNF595 ENSG00000272602 C2H2 ZF Known motif – High-throughput in vitro [1,420] GGGAGGGMWKC
ZNF596 ENSG00000172748 C2H2 ZF Known motif – High-throughput in vitro [1,421] VGVRRGAGVSMGAGM
ZNF597 ENSG00000167981 C2H2 ZF Known motif – High-throughput in vitro [1,422] CAARATGGCGKM
ZNF598 ENSG00000167962 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,423]
ZNF599 ENSG00000153896 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,424]
ZNF600 ENSG00000189190 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,425]
ZNF605 ENSG00000196458 C2H2 ZF Known motif – High-throughput in vitro [1,426] DGGKNNDDAGRVVCCMNRVD
ZNF606 ENSG00000166704 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,427]
ZNF607 ENSG00000198182 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,428]
ZNF608 ENSG00000168916 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,429]
ZNF609 ENSG00000180357 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,430]
ZNF610 ENSG00000167554 C2H2 ZF Known motif – High-throughput in vitro [1,431] GGAGCGGC
ZNF611 ENSG00000213020 C2H2 ZF Known motif – High-throughput in vitro [1,432] GGAGMGCCBVNGVVBVSCBSB
ZNF613 ENSG00000176024 C2H2 ZF Known motif – High-throughput in vitro [1,433] WAAAAAAAB
ZNF614 ENSG00000142556 C2H2 ZF Known motif – In vivo/Misc source [1,434] BDCTTKAKCTMATKD
ZNF615 ENSG00000197619 C2H2 ZF Known motif – High-throughput in vitro [1,435] AAABDVCTGYBSCCC
ZNF616 ENSG00000204611 C2H2 ZF Known motif – High-throughput in vitro [1,436] RHRGGTGAGCRY
ZNF618 ENSG00000157657 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,437]
ZNF619 ENSG00000177873 C2H2 ZF Known motif – In vivo/Misc source [1,438] BYNNBCCCCNNCCYCAGGAAT
ZNF620 ENSG00000177842 C2H2 ZF Known motif – In vivo/Misc source [1,439] WKTSYAKTY
ZNF621 ENSG00000172888 C2H2 ZF Known motif – In vivo/Misc source [1,440] RRRVKCYCAGGGMAG
ZNF623 ENSG00000183309 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,441]
ZNF624 ENSG00000197566 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,442]
ZNF625 ENSG00000257591 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,443]
ZNF626 ENSG00000188171 C2H2 ZF Known motif – High-throughput in vitro [1,444] HDVRTNNKGYTVHKVTGBYCCYTSYH
ZNF627 ENSG00000198551 C2H2 ZF Known motif – High-throughput in vitro [1,445] TTTAAGCCCACTGTTGAG
ZNF628 ENSG00000197483 C2H2 ZF Known motif – In vivo/Misc source [1,446] GCAACCAACCTTG
ZNF629 ENSG00000102870 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,447]
ZNF630 ENSG00000221994 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,448]
ZNF639 ENSG00000121864 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,449]
ZNF641 ENSG00000167528 C2H2 ZF Known motif – High-throughput in vitro [1,450] TGGGGGGGT
ZNF644 ENSG00000122482 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,451]
ZNF645 ENSG00000175809 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,452]
ZNF646 ENSG00000167395 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,453]
ZNF648 ENSG00000179930 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,454]
ZNF649 ENSG00000198093 C2H2 ZF Known motif – High-throughput in vitro [1,455] ATATAA
ZNF652 ENSG00000198740 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,456]
ZNF653 ENSG00000161914 C2H2 ZF; AT hook Known motif – In vivo/Misc source [1,457] WTTHNYDHCYKCCGACWNHWAWD
ZNF654 ENSG00000175105 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,458]
ZNF655 ENSG00000197343 C2H2 ZF Known motif – High-throughput in vitro [1,459] RVTAH
ZNF658 ENSG00000274349 C2H2 ZF Known motif – In vivo/Misc source [1,460] GGGGTRGGACGAGGTGGG
ZNF66 ENSG00000160229 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,461]
ZNF660 ENSG00000144792 C2H2 ZF Known motif – High-throughput in vitro [1,462] DYAGGDTGGRBHATCADB
ZNF662 ENSG00000182983 C2H2 ZF Known motif – High-throughput in vitro [1,463] DRNAGSMVVGKGMYAGMB
ZNF664 ENSG00000179195 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,464] GTTBAAWMCGC
ZNF665 ENSG00000197497 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,465]
ZNF667 ENSG00000198046 C2H2 ZF Known motif – High-throughput in vitro [1,466] GCYTTAARAGCTCANCH
ZNF668 ENSG00000167394 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,467]
ZNF669 ENSG00000188295 C2H2 ZF Known motif – High-throughput in vitro [1,468] VNHHRSANYGGTCRTCRNCCH
ZNF670 ENSG00000277462 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,469]
ZNF671 ENSG00000083814 C2H2 ZF Known motif – High-throughput in vitro [1,470] GAKTGGADBRV
ZNF672 ENSG00000171161 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,471]
ZNF674 ENSG00000251192 C2H2 ZF Known motif – High-throughput in vitro [1,472] GGRBCVCCRVV
ZNF675 ENSG00000197372 C2H2 ZF Known motif – High-throughput in vitro [1,473] RKGVNHNRGRGGMYAAAAYGD
ZNF676 ENSG00000196109 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,474]
ZNF677 ENSG00000197928 C2H2 ZF Known motif – High-throughput in vitro [1,475] GRAMMCHRAHAAGAWCAGHH
ZNF678 ENSG00000181450 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,476]
ZNF679 ENSG00000197123 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,477] DGGCAGCAGM
ZNF680 ENSG00000173041 C2H2 ZF Known motif – High-throughput in vitro [1,478] HNNNNDGNCMAAGAAGAHTNW
ZNF681 ENSG00000196172 C2H2 ZF Known motif – High-throughput in vitro [1,479] VAAGGABGVNGR
ZNF682 ENSG00000197124 C2H2 ZF Known motif – High-throughput in vitro [1,480] DDHYMAGCCC
ZNF683 ENSG00000176083 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,481]
ZNF684 ENSG00000117010 C2H2 ZF Known motif – High-throughput in vitro [1,482] BACAGTCCACCCCTTDV
ZNF687 ENSG00000143373 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,483]
ZNF688 ENSG00000229809 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,484]
ZNF689 ENSG00000156853 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,485]
ZNF69 ENSG00000198429 C2H2 ZF Known motif – In vivo/Misc source [1,486] GGRGSHGGGGBDGGV
ZNF691 ENSG00000164011 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,487] RKGAGYAC
ZNF692 ENSG00000171163 C2H2 ZF Known motif – In vivo/Misc source [1,488] SBGGGVCCCACH
ZNF695 ENSG00000197472 C2H2 ZF Known motif – In vivo/Misc source [1,489] ACCAMMHMC
ZNF696 ENSG00000185730 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,490]
ZNF697 ENSG00000143067 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,491] KKKGCGAGGGM
ZNF699 ENSG00000196110 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,492]
ZNF7 ENSG00000147789 C2H2 ZF Known motif – High-throughput in vitro [1,493] VWRRMADYWNYAARWGBWGRC
ZNF70 ENSG00000187792 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,494]
ZNF700 ENSG00000196757 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,495]
ZNF701 ENSG00000167562 C2H2 ZF Known motif – High-throughput in vitro [1,496] GAGMASYHDRGG
ZNF703 ENSG00000183779 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,497]
ZNF704 ENSG00000164684 C2H2 ZF Known motif – High-throughput in vitro [1,498] HRCCGGCCGGYD
ZNF705A ENSG00000196946 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,499] CCAAAARAAYY
ZNF705B ENSG00000215356 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,500] CCAAAARAAYY
ZNF705D ENSG00000215343 C2H2 ZF Inferred motif from similar protein – In vivo/Misc source [1,501] CCAAAARAAYY
ZNF705E ENSG00000214534 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,502]
ZNF705G ENSG00000215372 C2H2 ZF Known motif – In vivo/Misc source [1,503] RAKAAACCTCY
ZNF706 ENSG00000120963 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,504]
ZNF707 ENSG00000181135 C2H2 ZF Known motif – High-throughput in vitro [1,505] DACMAGGAGTGGGGTK
ZNF708 ENSG00000182141 C2H2 ZF Known motif – High-throughput in vitro [1,506] RDDAGGYACAGCH
ZNF709 ENSG00000242852 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,507]
ZNF71 ENSG00000197951 C2H2 ZF Known motif – High-throughput in vitro [1,508] BRGNRGSMRRRGVRARRARRGMAA
ZNF710 ENSG00000140548 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,509]
ZNF711 ENSG00000147180 C2H2 ZF Known motif – In vivo/Misc source [1,510] MGGCCTVS
ZNF713 ENSG00000178665 C2H2 ZF Known motif – High-throughput in vitro [1,511] WAGAMRAAWGCCACGAA
ZNF714 ENSG00000160352 C2H2 ZF Known motif – High-throughput in vitro [1,512] DKMRKTSCTGCT
ZNF716 ENSG00000182111 C2H2 ZF Known motif – High-throughput in vitro [1,513] VTATTTCY
ZNF717 ENSG00000227124 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,514]
ZNF718 ENSG00000250312 C2H2 ZF Known motif – In vivo/Misc source [1,515] GGGRATWGCGM
ZNF721 ENSG00000182903 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,516]
ZNF724 ENSG00000196081 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,517]
ZNF726 ENSG00000213967 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,518]
ZNF727 ENSG00000214652 C2H2 ZF Known motif – In vivo/Misc source [1,519] GGTCCAAWTGM
ZNF728 ENSG00000269067 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,520]
ZNF729 ENSG00000196350 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,521]
ZNF730 ENSG00000183850 C2H2 ZF Known motif – High-throughput in vitro [1,522] GGGMRGSBRNGG
ZNF732 ENSG00000186777 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,523]
ZNF735 ENSG00000223614 C2H2 ZF Known motif – In vivo/Misc source [1,524] DGGCAGCAGM
ZNF736 ENSG00000234444 C2H2 ZF Known motif – High-throughput in vitro [1,525] YCYRGGGYTTTT
ZNF737 ENSG00000237440 C2H2 ZF Known motif – In vivo/Misc source [1,526] RKRVDGRDGVWGGDG
ZNF74 ENSG00000185252 C2H2 ZF Known motif – In vivo/Misc source [1,527] RAAGATGTTCHYYDCVKYRTTRTTTAHVW
ZNF740 ENSG00000139651 C2H2 ZF Known motif – High-throughput in vitro [1,528] YNCCCCCCCCAC
ZNF746 ENSG00000181220 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,529]
ZNF747 ENSG00000169955 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,530]
ZNF749 ENSG00000186230 C2H2 ZF Known motif – High-throughput in vitro [1,531] GYTGGGGYT
ZNF750 ENSG00000141579 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,532]
ZNF75A ENSG00000162086 C2H2 ZF Known motif – High-throughput in vitro [1,533] TGTGGGAAAASM
ZNF75D ENSG00000186376 C2H2 ZF Known motif – High-throughput in vitro [1,534] GTGGGAAAKCCTTYH
ZNF76 ENSG00000065029 C2H2 ZF Known motif – High-throughput in vitro [1,535] HWCCCABAATGCAHYRCR
ZNF761 ENSG00000160336 C2H2 ZF Known motif – In vivo/Misc source [1,536] KGDWAATCAKA
ZNF763 ENSG00000197054 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,537]
ZNF764 ENSG00000169951 C2H2 ZF Known motif – In vivo/Misc source [1,538] TGCARCCYAGCTCTAYDAGMC
ZNF765 ENSG00000196417 C2H2 ZF Known motif – High-throughput in vitro [1,539] CTBGGCHVNGCMCWGVS
ZNF766 ENSG00000196214 C2H2 ZF Known motif – In vivo/Misc source [1,540] RAKAAACCYYH
ZNF768 ENSG00000169957 C2H2 ZF Known motif – High-throughput in vitro [1,541] CHCAGAGAGGKYRAG
ZNF77 ENSG00000175691 C2H2 ZF Known motif – In vivo/Misc source [1,542] TYMYCACTYCACYHNNNHMAD
ZNF770 ENSG00000198146 C2H2 ZF Known motif – In vivo/Misc source [1,543] GGAGGCYGVVV
ZNF771 ENSG00000179965 C2H2 ZF Known motif – High-throughput in vitro [1,544] RCGCTAACCAYTD
ZNF772 ENSG00000197128 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,545]
ZNF773 ENSG00000152439 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,546]
ZNF774 ENSG00000196391 C2H2 ZF Known motif – High-throughput in vitro [1,547] DGRRRVRGAGVHDGRRD
ZNF775 ENSG00000196456 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,548]
ZNF776 ENSG00000152443 C2H2 ZF Known motif – High-throughput in vitro [1,549] GAAGCAHRRYGCYGGCATCTG
ZNF777 ENSG00000196453 C2H2 ZF Known motif – In vivo/Misc source [1,550] GHCCSYCCCGTCSARCAAW
ZNF778 ENSG00000170100 C2H2 ZF Known motif – High-throughput in vitro [1,551] CAGACRMCRRCH
ZNF780A ENSG00000197782 C2H2 ZF Known motif – High-throughput in vitro [1,552] VNNNNDNNHDGGCAGGYNBNYDDV
ZNF780B ENSG00000128000 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,553]
ZNF781 ENSG00000196381 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,554]
ZNF782 ENSG00000196597 C2H2 ZF Known motif – In vivo/Misc source [1,555] HARRHCCWACAHVDRGRSHNYCTCAVRVVY
ZNF783 ENSG00000204946 C2H2 ZF Known motif – In vivo/Misc source [1,556] SBTSCWSCDSCDSYDSCWGCT
ZNF784 ENSG00000179922 C2H2 ZF Known motif – High-throughput in vitro [1,557] ACYTWCCK
ZNF785 ENSG00000197162 C2H2 ZF Known motif – In vivo/Misc source [1,558] ACWBRBRCAYACASWYVMMCVMACACASA
ZNF786 ENSG00000197362 C2H2 ZF Known motif – In vivo/Misc source [1,559] CRGRGNCCCRRRGRC
ZNF787 ENSG00000142409 C2H2 ZF Known motif – High-throughput in vitro [1,560] BGAGGCANNNNNNNTGCATY
ZNF788 ENSG00000214189 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,561]
ZNF789 ENSG00000198556 C2H2 ZF Known motif – High-throughput in vitro [1,562] CYYSTGACACCH
ZNF79 ENSG00000196152 C2H2 ZF Known motif – High-throughput in vitro [1,563] AAAVRAAWDAATNTCTAA
ZNF790 ENSG00000197863 C2H2 ZF Known motif – High-throughput in vitro [1,564] GTGCAGCA
ZNF791 ENSG00000173875 C2H2 ZF Known motif – In vivo/Misc source [1,565] CKCTGACCCCDCCTCCYBTCTAAA
ZNF792 ENSG00000180884 C2H2 ZF Known motif – In vivo/Misc source [1,566] DRCTGDTKWNHDBAGATAGKR
ZNF793 ENSG00000188227 C2H2 ZF Known motif – High-throughput in vitro [1,567] GARCCCCAAGVV
ZNF799 ENSG00000196466 C2H2 ZF Known motif – High-throughput in vitro [1,568] AYMCYBGYTGTCTCAGTGWTTKGS
ZNF8 ENSG00000278129 C2H2 ZF Known motif – High-throughput in vitro [1,569] DHNDDGRCRTACCRBV
ZNF80 ENSG00000174255 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,570]
ZNF800 ENSG00000048405 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,571]
ZNF804A ENSG00000170396 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,572]
ZNF804B ENSG00000182348 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,573]
ZNF805 ENSG00000204524 C2H2 ZF Known motif – High-throughput in vitro [1,574] MYKSCATTCCWTKSCWTKYSR
ZNF808 ENSG00000198482 C2H2 ZF Known motif – High-throughput in vitro [1,575] GGNWGGWCTVYAAAVNVSHYKBTHNDKND
ZNF81 ENSG00000197779 C2H2 ZF Known motif – High-throughput in vitro [1,576] TGGTVNHACYABYNNRRA
ZNF813 ENSG00000198346 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,577]
ZNF814 ENSG00000204514 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,578]
ZNF816 ENSG00000180257 C2H2 ZF Known motif – High-throughput in vitro [1,579] VVNNRDGGGGACMKGHND
ZNF821 ENSG00000102984 C2H2 ZF Known motif – High-throughput in vitro [1,580] HRGACAGACVGACR
ZNF823 ENSG00000197933 C2H2 ZF Known motif – High-throughput in vitro [1,581] HHYTTCTCYNYYBCY
ZNF827 ENSG00000151612 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,582]
ZNF829 ENSG00000185869 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,583]
ZNF83 ENSG00000167766 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,584]
ZNF830 ENSG00000198783 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,585]
ZNF831 ENSG00000124203 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,586]
ZNF835 ENSG00000127903 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,587]
ZNF836 ENSG00000196267 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,588]
ZNF837 ENSG00000152475 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,589]
ZNF84 ENSG00000198040 C2H2 ZF Known motif – High-throughput in vitro [1,590] RVRRVNNVNRDGAACAGGMAR
ZNF841 ENSG00000197608 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,591]
ZNF843 ENSG00000176723 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,592]
ZNF844 ENSG00000223547 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,593]
ZNF845 ENSG00000213799 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,594]
ZNF846 ENSG00000196605 C2H2 ZF Known motif – In vivo/Misc source [1,595] GVGSMVGGGMSVSVG
ZNF85 ENSG00000105750 C2H2 ZF Known motif – High-throughput in vitro [1,596] BRGATTMCWKCA
ZNF850 ENSG00000267041 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,597]
ZNF852 ENSG00000178917 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,598] VYAHACTKTNRAGYGV
ZNF853 ENSG00000236609 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,599]
ZNF860 ENSG00000197385 C2H2 ZF Known motif – High-throughput in vitro [1,600] VRCAGGGAGCVRVVS
ZNF865 ENSG00000261221 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,601]
ZNF878 ENSG00000257446 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,602]
ZNF879 ENSG00000234284 C2H2 ZF Known motif – High-throughput in vitro [1,603] AHARHAMWAHWRAAMMWANWWRVH
ZNF880 ENSG00000221923 C2H2 ZF Known motif – High-throughput in vitro [1,604] DDNDDVDNGGGRRDGGGARAGDGMAR
ZNF883 ENSG00000228623 C2H2 ZF Known motif – In vivo/Misc source [1,605] GAGGCAGCCACH
ZNF888 ENSG00000213793 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,606]
ZNF891 ENSG00000214029 C2H2 ZF Known motif – High-throughput in vitro [1,607] BNNNNSNGRCWKCYAGCC
ZNF90 ENSG00000213988 C2H2 ZF Known motif – High-throughput in vitro [1,608] TGGGTGDRTMAKCAG
ZNF91 ENSG00000167232 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,609]
ZNF92 ENSG00000146757 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,610]
ZNF93 ENSG00000184635 C2H2 ZF Known motif – High-throughput in vitro [1,611] BNNNBNHNGCWGCHRBSNYWGCTRCYDYC
ZNF98 ENSG00000197360 C2H2 ZF Known motif – High-throughput in vitro [1,612] VNADRKMCAANAAAAAGGHM
ZNF99 ENSG00000213973 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,613]
ZSCAN1 ENSG00000152467 C2H2 ZF Known motif – High-throughput in vitro [1,614] HRCACACVCTGHMAVH
ZSCAN10 ENSG00000130182 C2H2 ZF Inferred motif from similar protein – High-throughput in vitro [1,615] GDRAGTGC
ZSCAN12 ENSG00000158691 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,616]
ZSCAN16 ENSG00000196812 C2H2 ZF Known motif – High-throughput in vitro [1,617] GAGGCTCTGTTAACANY
ZSCAN18 ENSG00000121413 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,618]
ZSCAN2 ENSG00000176371 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,619]
ZSCAN20 ENSG00000121903 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,620]
ZSCAN21 ENSG00000166529 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,621]
ZSCAN22 ENSG00000182318 C2H2 ZF Known motif – High-throughput in vitro [1,622] GNCHGABGGMGGAGGCNV
ZSCAN23 ENSG00000187987 C2H2 ZF Known motif – High-throughput in vitro [1,623] BTGTAATTAGCACATGR
ZSCAN25 ENSG00000197037 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,624]
ZSCAN26 ENSG00000197062 C2H2 ZF Known motif – In vivo/Misc source [1,625] TGGGGGGCATM
ZSCAN29 ENSG00000140265 C2H2 ZF Known motif – High-throughput in vitro [1,626] MCGYRTARMCGKCTAYRC
ZSCAN30 ENSG00000186814 C2H2 ZF Known motif – High-throughput in vitro [1,627] BCCWGSRGCCHBSVS
ZSCAN31 ENSG00000235109 C2H2 ZF Known motif – High-throughput in vitro [1,628] GHHGCAGGGCARTTATGC
ZSCAN32 ENSG00000140987 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,629]
ZSCAN4 ENSG00000180532 C2H2 ZF Known motif – High-throughput in vitro [1,630] HGCACACVCTGNMA
ZSCAN5A ENSG00000131848 C2H2 ZF Known motif – High-throughput in vitro [1,631] HKTCCCYVCVCAAADM
ZSCAN5B ENSG00000197213 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,632]
ZSCAN5C ENSG00000204532 C2H2 ZF Known motif – High-throughput in vitro [1,633] GTGAGTNHAYRRRNV
ZSCAN9 ENSG00000137185 C2H2 ZF Known motif – High-throughput in vitro [1,634] DRKGATAAGATAAGAABCM
ZUFSP ENSG00000153975 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,635]
ZXDA ENSG00000198205 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,636]
ZXDB ENSG00000198455 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,637]
ZXDC ENSG00000070476 C2H2 ZF Likely sequence specific TF according to literature or domain structure – No motif [1,638]
ZZZ3 ENSG00000036549 Myb/SANT Known motif – High-throughput in vitro [1,639] SAATCCAW

References

  1. Lambert, Samuel; Arttu, Jolma; Campitelli, Laura; Das, Pratyush; Yin, Yimeng; Albu, Mihai; Chen, Xiaoting; Taipale, Jussi et al. (February 2018). "The Human Transcription Factors". Cell 172 (4): 650–665. doi:10.1016/j.cell.2018.01.029. PMID 29425488.