Biology:Neuromedin B

From HandWiki
Revision as of 05:56, 13 February 2024 by WikiEditor (talk | contribs) (url)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
neuromedin B
Identifiers
SymbolNMB
NCBI gene4828
HGNC7842
OMIM162340
RefSeqNM_021077
UniProtP08949
Other data
LocusChr. 15 q11-qter

Neuromedin B (NMB) is a bombesin-related peptide in mammals.[1][2] It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract.[3]

Sequence

The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromedin B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is: TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2).[4] The (NH2) here indicates a post-translational modification -- alpha amidation of the carboxy terminus.

Function

Figure 1: NMB, 7-TMR receptor and G-protein
Figure 2 : Signal Cascade after NMB binding

Neuromedin regulates the following functions:

  • exocrine and endocrine secretions
  • cell growth
  • body temperature
  • blood pressure and glucose level
  • sneezing[5]

Neuromedin signaling pathway

NMB acts by binding to its high affinity cell surface receptor, neuromedin B receptor (NMBR). This receptor is a G protein-coupled receptor with seven transmembrane spanning regions, hence the receptor is also denoted as a 7-transmembrane receptor (7-TMR). Upon binding several intracellular signaling pathways are triggered (see Figure 2).

When NMB binds to its 7-TMR, the heterotrimeric G protein that is attached to the receptor is activated. The G-protein is called heterotrimeric because it consists of 3 polypeptides: α subunit, β subunit, and γ subunit. In the activated NMBR/G-protein complex, there occurs an exchange of GTP for GDP bound to G-α subunit. The G-α subunit, in turn, dissociated form the G-βγ subunits. The free G-α inactivates adenylate cyclase (AC), which, in turn, catalyzes the conversion of ATP to cAMP, the latter of which functioning as a second messenger. cAMP activates of the enzyme Protein Kinase A (PKA). PKA enters the nucleus and activates the cAMP response element-binding protein. The activated CREB binds along with CREB binding protein, co-activator to the CRE region of the DNA in the nucleus. CREB and CBP are held together by leucine zippers. CRE is the control that activates number of growth factors, and thus cell proliferation and some anti-apoptotic genes. In the brain, CREB plays a role in long-term memory and learning.

References

  1. "Neuromedin B". Progress in Neurobiology 62 (3): 297–312. October 2000. doi:10.1016/S0301-0082(00)00004-6. PMID 10840151. 
  2. "International Union of Pharmacology. LXVIII. Mammalian bombesin receptors: nomenclature, distribution, pharmacology, signaling, and functions in normal and disease states". Pharmacological Reviews 60 (1): 1–42. March 2008. doi:10.1124/pr.107.07108. PMID 18055507. 
  3. "Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin". The Journal of Biological Chemistry 263 (26): 13317–23. September 1988. doi:10.1016/S0021-9258(18)37707-X. PMID 2458345. 
  4. "Neuromedin B and gastrin-releasing peptide mRNAs are differentially distributed in the rat nervous system". The Journal of Neuroscience 10 (9): 2917–30. September 1990. doi:10.1523/JNEUROSCI.10-09-02917.1990. PMID 2398368. 
  5. "Sneezing reflex is mediated by a peptidergic pathway from nose to brainstem". Cell 184 (14): 3762–3773.e10. June 2021. doi:10.1016/j.cell.2021.05.017. PMID 34133943. 

External links