Biology:Big dynorphin
| File:Big dynorphin 2D.svg | |
| Names | |
|---|---|
| IUPAC name
L-tyrosyl-glycyl-glycyl-L-phenylalanyl-L-leucyl-L-arginyl-L-arginyl-L-isoleucyl-L-arginyl-L-prolyl-L-lysyl-L-leucyl-L-lysyl-L-tryptophyl-L-alpha-aspartyl-L-asparagyl-L-glutaminyl-L-lysyl-L-arginyl-L-tyrosyl-glycyl-glycyl-L-phenylalanyl-L-leucyl-L-arginyl-L-arginyl-L-glutaminyl-L-phenylalanyl-L-lysyl-L-valyl-L-valyl-L-threonine
| |
Other names
| |
| Identifiers | |
3D model (JSmol)
|
|
| ChemSpider | |
PubChem CID
|
|
| |
| |
| Properties | |
| C185H292N58O41 | |
| Molar mass | 3985 |
Except where otherwise noted, data are given for materials in their standard state (at 25 °C [77 °F], 100 kPa). | |
| Infobox references | |
Big dynorphin is an endogenous opioid peptide of the dynorphin family. It forms when a precursor protein prodynorphin is not fully processed, resulting in a 32-amino acid molecule containing both dynorphin A and dynorphin B sequences. It has the amino acid sequence: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr.[2][3]
Big dynorphin is a highly efficiacious principal endogenous agonist at the human κ-opioid receptor (KOR).[2][4] It produces one of the strongest responses at GPR139 receptor among dynorphins.[5] Additionally, it uniquely modulates NMDA receptor and potentiates acid-sensing ion channel 1a (ASIC1a).[6][7]
It plays a role in pain and stress responses. It exhibits both analgesic and pro-nociceptive properties.[8] In mice it modulates memory and learning, and has anxiolytic properties, contributing to homeostatic regulation of opioid signaling in the central nervous system.[3][6][8]
Fragments
Big dynorphin1-32 is the primary endogenously documented big dynorphin form, but various shorter big dynorphin fragments have been synthesized for research purposes. These include (2-32), (2-26), (9-19) forms.[7]
Synthesis
Big dynorphin is generated through the proteolytic processing of prodynorphin (PDYN), a 26-kilodalton precursor protein by proprotein convertase 1.[9] The synthesis occurs within the neuronal cell body through translation of prodynorphin mRNA. Following translation, prodynorphin undergoes sequential processing by proprotein convertases, primarily PC1/3 and PC2, as well as the cysteine protease cathepsin L.[4][10]
Under normal circumstances, in the presence of carboxypeptidase E, prodynorphin is fully processed by sequential cleavage at dibasic amino acid sites to generate individual dynorphin peptides: dynorphin A1-17, dynorphin B, and α-neoendorphin.[9] Big dynorphin forms when this proteolytic processing is incomplete, typically resulting from insufficient proprotein convertase activity or altered intracellular calcium levels during neurotransmitter release events.[11] The 32-amino acid peptide comprises the complete dynorphin A sequence (residues 1-17) joined to the complete dynorphin B sequence, with two C-terminal amino acids.
Release mechanism
Peptide's release occurs primarily in a calcium-dependent manner through exocytosis of large dense core vesicles in the presynaptic terminal.[12] Big dynorphin immunoreactivity has been detected in regions such as the nucleus accumbens, caudate nucleus, and hippocampus, with significant levels detected in cerebrospinal fluid. The ratio of big dynorphin to dynorphin B in human brain tissue is approximately 1:3.[4]
Pharmacology
Opioid receptors
| Target | Affinity (Ki, nM) |
|---|---|
| KOR | 0.198 (Ki) 0.741 (EC50) 159% (Emax) |
| MOR | 14 (Ki) 87 (EC50) 115% (Emax) |
| DOR | 43 (Ki) 119 (EC50) 100% (Emax) |
| NOP | 105 |
| ASIC1 | 26-211 (EC50) |
| Notes: The smaller the value, the more avidly the drug interacts with the site. Max. stimulation is shown as percentage of that induced by dyn A1-17 Sources: [4][7][13] | |
Big dynorphin acts as a potent full agonist at the human κ-opioid receptor (KOR), exhibiting extremely high relative efficacy at this target.[4] In one binding assay it demonstrated similar affinity to dynorphin A, but about 14 to 32-fold higher potency to activate G proteins than other dynorphin peptides.[4] In contrast, other studies have suggested similar or higher potencies of other dynorphins.[14][15]
The peptide is also an agonist of other opioid receptors, It is 70-fold selective towards KOR over μ-opioid receptors (MOR) and 200 over δ-opioid receptor (DOR).[4]
In older guinea-pig ileum bioassay measuring native receptor function, big dynorphin shows approximately 10-20-fold reduced potency relative to dynorphin A, possibly due to conformational constraints of the larger peptide affecting receptor binding in peripheral tissue. This discrepancy suggests that big dynorphin's efficacy in human KOR systems may not translate directly to potency in peripheral tissue.[16]
Big dynorphin could theoretically produce some of the classical pharmacological effects associated with KOR agonism such as dysphoria, dissociation, and sedation, but this has not been directly evaluated.[4][17] Similarly biased signaling of big dynorphin at KOR has not yet been assessed.[18]
GPR139 receptor
Big dynorphin is one of the activators of the GPR139, a G protein-coupled receptor (GPCR), recently deorphanized as a dynorphin receptor. In a wide neuropeptide library screen it exhibited one of the highest efficacies among prodynorphin-derived peptides.[5]
At low concentrations, dynorphins predominantly activate canonical opioid receptors (KOR, MOR, DOR), while at higher concentrations, they additionally recruit GPR139. This receptor couples to Gq/11 G protein-mediated signaling, which is mechanistically opposite to the Gi/o inhibitory signaling of classical opioid receptors. This permits GPR139 to function as a molecular homeostatic brake: when dynorphin reaches high concentrations during intense stress or pain, simultaneous GPR139 activation counteracts excessive opioid receptor signaling through excitatory signaling pathways, preventing pathological over-inhibition of neuronal activity.[5]
NMDA receptor
NMDA receptors are modulated by big dynorphin, producing effects that are antagonist-insensitive to opioid receptor blockade.[6] Intracerebroventricular injection of big dynorphin produced memory enhancement in passive avoidance tests, enhanced locomotor activity in the open field test, and anxiolytic-like effects that were blocked by the NMDA receptor antagonist MK-801 but resistant to nor-BNI, a selective KOR antagonist.[6]
In contrast, dynorphin A and dynorphin B at similar doses produced analgesia (mediated by opioid receptors) but did not produce the NMDA-dependent memory enhancement, anxiolysis, or locomotor stimulation.[6]
Suggested mechanisms are interaction with the polyamine binding site or the NR2B subunit.[6] The molecular basis for this atypical activity may involve the extended C-terminal region unique to big dynorphin, which contains multiple basic residues (arginine and lysine).[19]
ASIC1a channel
Big dynorphin is a potent endogenous modulator of the acid-sensing ion channel 1a (ASIC1a) and current rescue following steady-state desensitization.[7][13] In comparison, dynorphin A exhibits a approximately 1000-fold lower potency than big dynorphin at this target.[7]
Peptide potentiates ASIC1a current through a mechanism independent of both opioid and bradykinin receptor signaling.[7] The potency correlates with big dynorphin's features, particularly its high net positive charge (9+) and abundance of arginine residues (6 total), with residues Arg6, Arg7. Big dynorphin rescues proton-gated currents and promotes acidosis-induced neuronal cell death in cultured cortical neurons, implicating it in pathological conditions involving cellular acidification and excitotoxicity.[20]
Functions and effects
Pain modulation
Like other dynorphin peptides, big dynorphin can produce analgesic effects through κ-opioid receptor (KOR) activation at spinal nociceptive sites.[17] However, at supraspinal levels through non-opioid mechanisms involving NMDA receptor modulation and ASIC1a activation, big dynorphin can produce pro-nociceptive effects, enhancing pain sensitivity in both acute and chronic pain states.[8]
Memory and learning
It has been shown that big dynorphin enhances learning in rodent models through NMDA receptor modulation.[6] This contrasts with the amnestic effects typically associated with opioid receptor agonists and other dynorphins. The mechanism may involve modulation of the NR2B subunit, a modulator of cortical synaptic plasticity and long-term potentiation (LTP).[6]
Clinical significance
Neurodegeneration and chronic pain
Big dynorphin is upregulated in spinal cord injury and chronic pain states, where excessive big dynorphin production through both opioid and non-opioid receptor mechanisms contribute to neuronal death, neuroinflammation, and pain chronification.[7]
Alzheimer's Disease
In contrary, big dynorphin exhibits neuroprotective properties against amyloid-β (Aβ) accumulation in Alzheimer's disease. It reduces the hydrophobicity and slows the aggregation kinetics of Aβ40, the most abundant amyloid species, resulting in around 2-fold reduction in amyloid aggregation compared to Aβ alone.[21] In human neuroblastoma cell cultures, big dynorphin pre-incubated with Aβ40 significantly increased cell viability to compared to Aβ40 alone.[21] The neuroprotective mechanism involves big dynorphin's cationic amino acid residues stabilizing negatively charged regions of Aβ, preventing the β-sheet transition and maintaining Aβ in an α-helical conformation.[21] These findings suggest therapeutic potential for big dynorphin-derived peptides in Alzheimer's disease treatment.
See also
References
- ↑ Big dynorphin - Compound Summary, PubChem.
- ↑ 2.0 2.1 "Big dynorphin: Biological activity". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. http://www.guidetopharmacology.org/GRAC/LigandDisplayForward?tab=biology&ligandId=3669. "Principal endogenous agonists at κ receptor"
- ↑ 3.0 3.1 "Big dynorphin: Structure – Peptide Sequence". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. http://www.guidetopharmacology.org/GRAC/LigandDisplayForward?tab=structure&ligandId=3669. "Peptide sequence
YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT
Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr" - ↑ 4.0 4.1 4.2 4.3 4.4 4.5 4.6 4.7 "Big dynorphin as a putative endogenous ligand for the kappa-opioid receptor". J. Neurochem. 97 (1): 292–301. 2006. doi:10.1111/j.1471-4159.2006.03732.x. ISSN 0022-3042. PMID 16515546.
- ↑ 5.0 5.1 5.2 "Homeostatic scaling of dynorphin signaling by a non-canonical opioid receptor". Nature Communications 16 (1). July 2025. doi:10.1038/s41467-025-62133-x. ISSN 2041-1723. PMID 40701991. Bibcode: 2025NatCo..16.6786L.
- ↑ 6.0 6.1 6.2 6.3 6.4 6.5 6.6 6.7 "Big Dynorphin, a Prodynorphin-Derived Peptide Produces NMDA Receptor-Mediated Effects on Memory, Anxiolytic-Like and Locomotor Behavior in Mice". Neuropsychopharmacology 31 (9): 1928–1937. 2005. doi:10.1038/sj.npp.1300959. ISSN 0893-133X. PMID 16292317.
- ↑ 7.0 7.1 7.2 7.3 7.4 7.5 7.6 "Dynorphin opioid peptides enhance acid-sensing ion channel 1a activity and acidosis-induced neuronal death". The Journal of Neuroscience 29 (45): 14371–14380. November 2009. doi:10.1523/JNEUROSCI.2186-09.2009. ISSN 0270-6474. PMID 19906984.
- ↑ 8.0 8.1 8.2 "Intrathecally administered big dynorphin, a prodynorphin-derived peptide, produces nociceptive behavior through an N-methyl-D-aspartate receptor mechanism". Brain Res. 952 (1): 7–14. 2002. doi:10.1016/S0006-8993(02)03180-3. ISSN 0006-8993. PMID 12363399.
- ↑ 9.0 9.1 "The Dynorphin/-Opioid Receptor System at the Interface of Hyperalgesia/Hyperkatifeia and Addiction" (in en). Current Addiction Reports 12 (1). February 2025. doi:10.1007/s40429-025-00618-x. ISSN 2196-2952. PMID 40124896. PMC 11925990. https://doi.org/10.1007/s40429-025-00618-x.
- ↑ "Prodynorphin processing by proprotein convertase 2. Cleavage at single basic residues and enhanced processing in the presence of carboxypeptidase activity". J. Biol. Chem. 273 (2): 829–836. January 1998. doi:10.1074/jbc.273.2.829. ISSN 0021-9258. PMID 9422738.
- ↑ "Nonopiate Effects of Dynorphin and Des-Tyr-Dynorphin" (in en). Science 218 (4577): 1136–1138. December 1982. doi:10.1126/science.6128791. ISSN 0036-8075. PMID 6128791. Bibcode: 1982Sci...218.1136W. https://www.science.org/doi/10.1126/science.6128791.
- ↑ "Dynorphin is a selective endogenous ligand of the κ-opioid receptor". Science 215 (4534): 413–415. January 1982. doi:10.1126/science.6120570. ISSN 0036-8075. PMID 6120570.
- ↑ 13.0 13.1 "Dynorphin Neuropeptides Decrease Apparent Proton Affinity of ASIC1a by Occluding the Acidic Pocket". Journal of Medicinal Chemistry 64 (18): 13299–13311. September 2021. doi:10.1021/acs.jmedchem.1c00447. ISSN 0022-2623. PMID 34461722. https://doi.org/10.1021/acs.jmedchem.1c00447.
- ↑ "Dynorphin A analogs for the treatment of chronic neuropathic pain". Future Medicinal Chemistry 8 (2): 165–177. 2016. doi:10.4155/fmc.15.164. ISSN 1756-8919. PMID 26824470.
- ↑ "Structure–function relationship of dynorphin B variants using naturally occurring amino acid substitutions" (in English). Frontiers in Pharmacology 15. October 2024. doi:10.3389/fphar.2024.1484730. ISSN 1663-9812. PMID 39539623.
- ↑ "Opioid receptor selectivity of dynorphin gene products." (in en). The Journal of Pharmacology and Experimental Therapeutics 228 (1): 88–93. January 1984. doi:10.1016/S0022-3565(25)21609-3. ISSN 0022-3565. https://linkinghub.elsevier.com/retrieve/pii/S0022356525216093.
- ↑ 17.0 17.1 "Dynorphin A activates bradykinin receptors to maintain neuropathic pain" (in en). Nature Neuroscience 9 (12): 1534–1540. January 1982. doi:10.1038/nn1804. ISSN 1097-6256. PMID 17115041. https://www.nature.com/articles/nn1804.
- ↑ "Biased signaling by endogenous opioid peptides". Proceedings of the National Academy of Sciences of the United States of America 117 (21): 11820–11828. May 2020. doi:10.1073/pnas.2000712117. ISSN 0027-8424. PMID 32393639. Bibcode: 2020PNAS..11711820G.
- ↑ "Dynorphin A inhibits NMDA receptors through a pH-dependent mechanism". Molecular and Cellular Neuroscience 24 (3): 525–537. November 2003. doi:10.1016/S1044-7431(03)00214-8. ISSN 1044-7431. PMID 14664805.
- ↑ "Mechanism and Binding Site of the ASIC1A-Big Dynorphin Interaction" (in en). Biophysical Journal 118 (3): 582a. February 2020. doi:10.1016/j.bpj.2019.11.3158. ISSN 0006-3495. Bibcode: 2020BpJ...118..582B. https://linkinghub.elsevier.com/retrieve/pii/S0006349519340913.
- ↑ 21.0 21.1 21.2 "Big dynorphin is a neuroprotector scaffold against amyloid β-peptide aggregation and cell toxicity". Computational and Structural Biotechnology Journal 20: 5672–5679. 2022. doi:10.1016/j.csbj.2022.10.014. ISSN 2001-0370. PMID 36284704.
