Biology:Big dynorphin
From HandWiki
Short description: Opioid peptide
Big dynorphin is an endogenous opioid peptide of the dynorphin family that is composed of both dynorphin A and dynorphin B.[1][2] Big dynorphin has the amino acid sequence: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr.[2] It has nociceptive and anxiolytic-like properties, as well as effects on memory in mice.[3][4]
Big dynorphin is a principal endogenous, agonist at the human kappa-opioid receptor.[1][5]
References
- ↑ 1.0 1.1 "Big dynorphin: Biological activity". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. http://www.guidetopharmacology.org/GRAC/LigandDisplayForward?tab=biology&ligandId=3669. "Principal endogenous agonists at κ receptor"
- ↑ 2.0 2.1 "Big dynorphin: Structure – Peptide Sequence". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. http://www.guidetopharmacology.org/GRAC/LigandDisplayForward?tab=structure&ligandId=3669. "Peptide sequence
YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT
Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr" - ↑ Kuzmin, Alexander; Madjid, Nather; Terenius, Lars; Ogren, Sven Ove; Bakalkin, Georgy (2005). "Big Dynorphin, a Prodynorphin-Derived Peptide Produces NMDA Receptor-Mediated Effects on Memory, Anxiolytic-Like and Locomotor Behavior in Mice". Neuropsychopharmacology 31 (9): 1928–1937. doi:10.1038/sj.npp.1300959. ISSN 0893-133X. PMID 16292317.
- ↑ "Intrathecally administered big dynorphin, a prodynorphin-derived peptide, produces nociceptive behavior through an N-methyl-D-aspartate receptor mechanism". Brain Res. 952 (1): 7–14. 2002. doi:10.1016/S0006-8993(02)03180-3. PMID 12363399.
- ↑ "Big dynorphin as a putative endogenous ligand for the kappa-opioid receptor". J. Neurochem. 97 (1): 292–301. 2006. doi:10.1111/j.1471-4159.2006.03732.x. PMID 16515546.
 |  |
