Biology:Homeobox: Difference between revisions

From HandWiki
(linkage)
 
(No difference)

Latest revision as of 08:53, 10 February 2024

Short description: DNA pattern affecting anatomy development
Homeodomain
Homeodomain-dna-1ahd.png
The Antennapedia homeodomain protein from Drosophila melanogaster bound to a fragment of DNA.[1] The recognition helix and unstructured N-terminus are bound in the major and minor grooves respectively.
Identifiers
SymbolHomeodomain
PfamPF00046
Pfam clanCL0123
InterProIPR001356
SMARTSM00389
PROSITEPDOC00027
SCOP21ahd / SCOPe / SUPFAM

A homeobox is a DNA sequence, around 180 base pairs long, that regulates large-scale anatomical features in the early stages of embryonic development. Mutations in a homeobox may change large-scale anatomical features of the full-grown organism.

Homeoboxes are found within genes that are involved in the regulation of patterns of anatomical development (morphogenesis) in animals, fungi, plants, and numerous single cell eukaryotes.[2] Homeobox genes encode homeodomain protein products that are transcription factors sharing a characteristic protein fold structure that binds DNA to regulate expression of target genes.[3][4][2] Homeodomain proteins regulate gene expression and cell differentiation during early embryonic development, thus mutations in homeobox genes can cause developmental disorders.[5]

Homeosis is a term coined by William Bateson to describe the outright replacement of a discrete body part with another body part, e.g. antennapedia—replacement of the antenna on the head of a fruit fly with legs.[6] The "homeo-" prefix in the words "homeobox" and "homeodomain" stems from this mutational phenotype, which is observed when some of these genes are mutated in animals. The homeobox domain was first identified in a number of Drosophila homeotic and segmentation proteins, but is now known to be well-conserved in many other animals, including vertebrates.[3][7][8]

Discovery

Drosophila with the antennapedia mutant phenotype exhibit homeotic transformation of the antennae into leg-like structures on the head.

The existence of homeobox genes was first discovered in Drosophila by isolating the gene responsible for a homeotic transformation where legs grow from the head instead of the expected antennae. Walter Gehring identified a gene called antennapedia that caused this homeotic phenotype.[9] Analysis of antennapedia revealed that this gene contained a 180 base pair sequence that encoded a DNA binding domain, which William McGinnis termed the "homeobox".[10] The existence of additional Drosophila genes containing the antennapedia homeobox sequence was independently reported by Ernst Hafen, Michael Levine, William McGinnis, and Walter Jakob Gehring of the University of Basel in Switzerland and Matthew P. Scott and Amy Weiner of Indiana University in Bloomington in 1984.[11][12] Isolation of homologous genes by Edward de Robertis and William McGinnis revealed that numerous genes from a variety of species contained the homeobox.[13][14] Subsequent phylogenetic studies detailing the evolutionary relationship between homeobox-containing genes showed that these genes are present in all bilaterian animals.

Homeodomain structure

The characteristic homeodomain protein fold consists of a 60-amino acid long domain composed of three alpha helixes. The following shows the consensus homeodomain (~60 amino acid chain):[15]

            Helix 1          Helix 2         Helix 3/4
         ______________    __________    _________________
RRRKRTAYTRYQLLELEKEFHFNRYLTRRRRIELAHSLNLTERHIKIWFQNRRMKWKKEN
....|....|....|....|....|....|....|....|....|....|....|....|
         10        20        30        40        50        60
The vnd/NK-2 homeodomain-DNA complex. Helix 3 of the homeodomain binds in the major groove of the DNA and the N-terminal arm binds in the minor groove, in analogy with other homeodomain-DNA complexes.

Helix 2 and helix 3 form a so-called helix-turn-helix (HTH) structure, where the two alpha helices are connected by a short loop region. The N-terminal two helices of the homeodomain are antiparallel and the longer C-terminal helix is roughly perpendicular to the axes established by the first two. It is this third helix that interacts directly with DNA via a number of hydrogen bonds and hydrophobic interactions, as well as indirect interactions via water molecules, which occur between specific side chains and the exposed bases within the major groove of the DNA.[7]

Homeodomain proteins are found in eukaryotes.[2] Through the HTH motif, they share limited sequence similarity and structural similarity to prokaryotic transcription factors,[16] such as lambda phage proteins that alter the expression of genes in prokaryotes. The HTH motif shows some sequence similarity but a similar structure in a wide range of DNA-binding proteins (e.g., cro and repressor proteins, homeodomain proteins, etc.). One of the principal differences between HTH motifs in these different proteins arises from the stereochemical requirement for glycine in the turn which is needed to avoid steric interference of the beta-carbon with the main chain: for cro and repressor proteins the glycine appears to be mandatory, whereas for many of the homeotic and other DNA-binding proteins the requirement is relaxed.

Sequence specificity

Homeodomains can bind both specifically and nonspecifically to B-DNA with the C-terminal recognition helix aligning in the DNA's major groove and the unstructured peptide "tail" at the N-terminus aligning in the minor groove. The recognition helix and the inter-helix loops are rich in arginine and lysine residues, which form hydrogen bonds to the DNA backbone. Conserved hydrophobic residues in the center of the recognition helix aid in stabilizing the helix packing. Homeodomain proteins show a preference for the DNA sequence 5'-TAAT-3'; sequence-independent binding occurs with significantly lower affinity. The specificity of a single homeodomain protein is usually not enough to recognize specific target gene promoters, making cofactor binding an important mechanism for controlling binding sequence specificity and target gene expression. To achieve higher target specificity, homeodomain proteins form complexes with other transcription factors to recognize the promoter region of a specific target gene.

Biological function

Homeodomain proteins function as transcription factors due to the DNA binding properties of the conserved HTH motif. Homeodomain proteins are considered to be master control genes, meaning that a single protein can regulate expression of many target genes. Homeodomain proteins direct the formation of the body axes and body structures during early embryonic development.[17] Many homeodomain proteins induce cellular differentiation by initiating the cascades of coregulated genes required to produce individual tissues and organs. Other proteins in the family, such as NANOG are involved in maintaining pluripotency and preventing cell differentiation.

Regulation

Hox genes and their associated microRNAs are highly conserved developmental master regulators with tight tissue-specific, spatiotemporal control. These genes are known to be dysregulated in several cancers and are often controlled by DNA methylation.[18][19] The regulation of Hox genes is highly complex and involves reciprocal interactions, mostly inhibitory. Drosophila is known to use the polycomb and trithorax complexes to maintain the expression of Hox genes after the down-regulation of the pair-rule and gap genes that occurs during larval development. Polycomb-group proteins can silence the Hox genes by modulation of chromatin structure.[20]

Mutations

Mutations to homeobox genes can produce easily visible phenotypic changes in body segment identity, such as the Antennapedia and Bithorax mutant phenotypes in Drosophila. Duplication of homeobox genes can produce new body segments, and such duplications are likely to have been important in the evolution of segmented animals.

Evolution

The homeobox itself may have evolved from a non-DNA-binding transmembrane domain at the C-terminus of the MraY enzyme. This is based on metagenomic data acquired from the transitional archaeon, Lokiarchaeum, that is regarded as the prokaryote closest to the ancestor of all eukaryotes.[21]Template:Rs inline

Phylogenetic analysis of homeobox gene sequences and homeodomain protein structures suggests that the last common ancestor of plants, fungi, and animals had at least two homeobox genes.[22] Molecular evidence shows that some limited number of Hox genes have existed in the Cnidaria since before the earliest true Bilatera, making these genes pre-Paleozoic.[23] It is accepted that the three major animal ANTP-class clusters, Hox, ParaHox, and NK (MetaHox), are the result of segmental duplications. A first duplication created MetaHox and ProtoHox, the latter of which later duplicated into Hox and ParaHox. The clusters themselves were created by tandem duplications of a single ANTP-class homeobox gene.[24] Gene duplication followed by neofunctionalization is responsible for the many homeobox genes found in eukaryotes.[25][26] Comparison of homeobox genes and gene clusters has been used to understand the evolution of genome structure and body morphology throughout metazoans.[27]

Types of homeobox genes

Hox genes

Hox gene expression in Drosophila melanogaster.
Main page: Biology:Hox gene

Hox genes are the most commonly known subset of homeobox genes. They are essential metazoan genes that determine the identity of embryonic regions along the anterior-posterior axis.[28] The first vertebrate Hox gene was isolated in Xenopus by Edward De Robertis and colleagues in 1984.[29] The main interest in this set of genes stems from their unique behavior and arrangement in the genome. Hox genes are typically found in an organized cluster. The linear order of Hox genes within a cluster is directly correlated to the order they are expressed in both time and space during development. This phenomenon is called colinearity.

Mutations in these homeotic genes cause displacement of body segments during embryonic development. This is called ectopia. For example, when one gene is lost the segment develops into a more anterior one, while a mutation that leads to a gain of function causes a segment to develop into a more posterior one. Famous examples are Antennapedia and bithorax in Drosophila, which can cause the development of legs instead of antennae and the development of a duplicated thorax, respectively.[30]

In vertebrates, the four paralog clusters are partially redundant in function, but have also acquired several derived functions. For example, HoxA and HoxD specify segment identity along the limb axis.[31][32] Specific members of the Hox family have been implicated in vascular remodeling, angiogenesis, and disease by orchestrating changes in matrix degradation, integrins, and components of the ECM.[33] HoxA5 is implicated in atherosclerosis.[34][35] HoxD3 and HoxB3 are proinvasive, angiogenic genes that upregulate b3 and a5 integrins and Efna1 in ECs, respectively.[36][37][38][39] HoxA3 induces endothelial cell (EC) migration by upregulating MMP14 and uPAR. Conversely, HoxD10 and HoxA5 have the opposite effect of suppressing EC migration and angiogenesis, and stabilizing adherens junctions by upregulating TIMP1/downregulating uPAR and MMP14, and by upregulating Tsp2/downregulating VEGFR2, Efna1, Hif1alpha and COX-2, respectively.[40][41] HoxA5 also upregulates the tumor suppressor p53 and Akt1 by downregulation of PTEN.[42] Suppression of HoxA5 has been shown to attenuate hemangioma growth.[43] HoxA5 has far-reaching effects on gene expression, causing ~300 genes to become upregulated upon its induction in breast cancer cell lines.[43] HoxA5 protein transduction domain overexpression prevents inflammation shown by inhibition of TNFalpha-inducible monocyte binding to HUVECs.[44][45]

LIM genes

Main page: Biology:LIM domain

LIM genes (named after the initial letters of the names of three proteins where the characteristic domain was first identified) encode two 60 amino acid cysteine and histidine-rich LIM domains and a homeodomain. The LIM domains function in protein-protein interactions and can bind zinc molecules. LIM domain proteins are found in both the cytosol and the nucleus. They function in cytoskeletal remodeling, at focal adhesion sites, as scaffolds for protein complexes, and as transcription factors.[46]

Pax genes

Main page: Biology:Pax genes

Most Pax genes contain a homeobox and a paired domain that also binds DNA to increase binding specificity, though some Pax genes have lost all or part of the homeobox sequence.[47] Pax genes function in embryo segmentation, nervous system development, generation of the frontal eye fields, skeletal development, and formation of face structures. Pax 6 is a master regulator of eye development, such that the gene is necessary for development of the optic vesicle and subsequent eye structures.[48]

POU genes

Main page: Biology:POU family

Proteins containing a POU region consist of a homeodomain and a separate, structurally homologous POU domain that contains two helix-turn-helix motifs and also binds DNA. The two domains are linked by a flexible loop that is long enough to stretch around the DNA helix, allowing the two domains to bind on opposite sides of the target DNA, collectively covering an eight-base segment with consensus sequence 5'-ATGCAAAT-3'. The individual domains of POU proteins bind DNA only weakly, but have strong sequence-specific affinity when linked. The POU domain itself has significant structural similarity with repressors expressed in bacteriophages, particularly lambda phage.

Plant homeobox genes

As in animals, the plant homeobox genes code for the typical 60 amino acid long DNA-binding homeodomain or in case of the TALE (three amino acid loop extension) homeobox genes for an atypical homeodomain consisting of 63 amino acids. According to their conserved intron–exon structure and to unique codomain architectures they have been grouped into 14 distinct classes: HD-ZIP I to IV, BEL, KNOX, PLINC, WOX, PHD, DDT, NDX, LD, SAWADEE and PINTOX.[25] Conservation of codomains suggests a common eukaryotic ancestry for TALE[49] and non-TALE homeodomain proteins.[50]

Human homeobox genes

The Hox genes in humans are organized in four chromosomal clusters:

name chromosome gene
HOXA (or sometimes HOX1) - HOXA@ chromosome 7 HOXA1, HOXA2, HOXA3, HOXA4, HOXA5, HOXA6, HOXA7, HOXA9, HOXA10, HOXA11, HOXA13
HOXB - HOXB@ chromosome 17 HOXB1, HOXB2, HOXB3, HOXB4, HOXB5, HOXB6, HOXB7, HOXB8, HOXB9, HOXB13
HOXC - HOXC@ chromosome 12 HOXC4, HOXC5, HOXC6, HOXC8, HOXC9, HOXC10, HOXC11, HOXC12, HOXC13
HOXD - HOXD@ chromosome 2 HOXD1, HOXD3, HOXD4, HOXD8, HOXD9, HOXD10, HOXD11, HOXD12, HOXD13

ParaHox genes are analogously found in four areas. They include CDX1, CDX2, CDX4; GSX1, GSX2; and PDX1. Other genes considered Hox-like include EVX1, EVX2; GBX1, GBX2; MEOX1, MEOX2; and MNX1. The NK-like (NKL) genes, some of which are considered "MetaHox", are grouped with Hox-like genes into a large ANTP-like group.[51][52]

Humans have a "distal-less homeobox" family: DLX1, DLX2, DLX3, DLX4, DLX5, and DLX6. Dlx genes are involved in the development of the nervous system and of limbs.[53] They are considered a subset of the NK-like genes.[51]

Human TALE (Three Amino acid Loop Extension) homeobox genes for an "atypical" homeodomain consist of 63 rather than 60 amino acids: IRX1, IRX2, IRX3, IRX4, IRX5, IRX6; MEIS1, MEIS2, MEIS3; MKX; PBX1, PBX2, PBX3, PBX4; PKNOX1, PKNOX2; TGIF1, TGIF2, TGIF2LX, TGIF2LY.[51]

In addition, humans have the following homeobox genes and proteins:[51]

  1. Grouped as Lmx 1/5, 2/9, 3/4, and 6/8.
  2. Grouped as Six 1/2, 3/6, and 4/5.
  3. Questionable, per [51]
  4. The Pax genes. Grouped as Pax2/5/8, Pax3/7, and Pax4/6.
  5. Nk4.
  6. Nk5.

See also

References

  1. PDB: 1AHD​; "Determination of the nuclear magnetic resonance solution structure of an Antennapedia homeodomain-DNA complex". Journal of Molecular Biology 234 (4): 1084–93. December 1993. doi:10.1006/jmbi.1993.1661. PMID 7903398. 
  2. 2.0 2.1 2.2 "Homeodomain proteins: an update". Chromosoma 125 (3): 497–521. June 2016. doi:10.1007/s00412-015-0543-8. PMID 26464018. 
  3. 3.0 3.1 "The homeobox in perspective". Trends in Biochemical Sciences 17 (8): 277–80. August 1992. doi:10.1016/0968-0004(92)90434-B. PMID 1357790. 
  4. "Exploring the homeobox". Gene 135 (1–2): 215–21. December 1993. doi:10.1016/0378-1119(93)90068-E. PMID 7903947. 
  5. Reference, Genetics Home. "Homeoboxes" (in en). https://ghr.nlm.nih.gov/primer/genefamily/homeoboxes. 
  6. Materials for the study of variation, treated with especial regard to discontinuity in the origin of species William Bateson 1861–1926. London : Macmillan 1894 xv, 598 p
  7. 7.0 7.1 Schofield PN (1987). "Patterns, puzzles and paradigms - The riddle of the homeobox". Trends Neurosci. 10: 3–6. doi:10.1016/0166-2236(87)90113-5. 
  8. "The structure and function of the homeodomain". Biochimica et Biophysica Acta (BBA) - Reviews on Cancer 989 (1): 25–48. July 1989. doi:10.1016/0304-419x(89)90033-4. PMID 2568852. 
  9. "Genomic and cDNA clones of the homeotic locus Antennapedia in Drosophila". The EMBO Journal 2 (11): 2027–36. 1983. doi:10.1002/j.1460-2075.1983.tb01696.x. PMID 6416827. 
  10. "Walter Jakob Gehring (1939-2014) | The Embryo Project Encyclopedia". https://embryo.asu.edu/pages/walter-jakob-gehring-1939-2014. 
  11. "A conserved DNA sequence in homoeotic genes of the Drosophila Antennapedia and bithorax complexes". Nature 308 (5958): 428–33. 1984. doi:10.1038/308428a0. PMID 6323992. Bibcode1984Natur.308..428M. 
  12. "Structural relationships among genes that control development: sequence homology between the Antennapedia, Ultrabithorax, and fushi tarazu loci of Drosophila". Proceedings of the National Academy of Sciences of the United States of America 81 (13): 4115–9. July 1984. doi:10.1073/pnas.81.13.4115. PMID 6330741. Bibcode1984PNAS...81.4115S. 
  13. Carrasco, Andrés E.; McGinnis, William; Gehring, Walter J.; De Robertis, Eddy M. (1984). "Cloning of an X. laevis gene expressed during early embryogenesis coding for a peptide region homologous to Drosophila homeotic genes" (in en). Cell 37 (2): 409–414. doi:10.1016/0092-8674(84)90371-4. PMID 6327066. 
  14. "A homologous protein-coding sequence in Drosophila homeotic genes and its conservation in other metazoans" (in en). Cell 37 (2): 403–8. June 1984. doi:10.1016/0092-8674(84)90370-2. PMID 6327065. https://www.cell.com/cell/abstract/0092-8674(84)90370-2. Retrieved 2019-12-09. 
  15. Bürglin TR. "The homeobox page" (gif). Karolinksa Institute. http://www.csb.ki.se/groups/tbu/homeo/consensus.gif. 
  16. "CATH Superfamily 1.10.10.60". http://www.cathdb.info/version/v4_0_0/superfamily/1.10.10.60. 
  17. "Differential DNA binding properties of three human homeodomain proteins". Nucleic Acids Research 20 (17): 4465–72. September 1992. doi:10.1093/nar/20.17.4465. PMID 1357628. 
  18. "Flow-Dependent Epigenetic DNA Methylation in Endothelial Gene Expression and Atherosclerosis". Arteriosclerosis, Thrombosis, and Vascular Biology 35 (7): 1562–9. July 2015. doi:10.1161/ATVBAHA.115.305042. PMID 25953647. 
  19. "HOX genes and their role in the development of human cancers". Journal of Molecular Medicine 92 (8): 811–23. August 2014. doi:10.1007/s00109-014-1181-y. PMID 24996520. 
  20. "The Role of RNAi and Noncoding RNAs in Polycomb Mediated Control of Gene Expression and Genomic Programming". RNA and the Regulation of Gene Expression: A Hidden Layer of Complexity. Caister Academic Press. 2008. ISBN 978-1-904455-25-7. http://www.horizonpress.com/rnareg. Retrieved 2008-02-27. 
  21. The origin of the Homeobox at the C-terminus of MraY in Lokiarchaea. 2018. doi:10.13140/RG.2.2.35941.65760. https://www.researchgate.net/publication/328511976. Retrieved 2018-10-26. 
  22. "Did homeodomain proteins duplicate before the origin of angiosperms, fungi, and metazoa?". Proceedings of the National Academy of Sciences of the United States of America 94 (25): 13749–53. December 1997. doi:10.1073/pnas.94.25.13749. PMID 9391098. Bibcode1997PNAS...9413749B. 
  23. "Pre-bilaterian origins of the Hox cluster and the Hox code: evidence from the sea anemone, Nematostella vectensis". PLOS ONE 2 (1): e153. January 2007. doi:10.1371/journal.pone.0000153. PMID 17252055. Bibcode2007PLoSO...2..153R. 
  24. "The genesis and evolution of homeobox gene clusters". Nature Reviews Genetics 6 (12): 881–92. December 2005. doi:10.1038/nrg1723. PMID 16341069. 
  25. 25.0 25.1 "A comprehensive classification and evolutionary analysis of plant homeobox genes". Molecular Biology and Evolution 26 (12): 2775–94. December 2009. doi:10.1093/molbev/msp201. PMID 19734295. 
  26. "Evolution of homeobox genes". Wiley Interdisciplinary Reviews: Developmental Biology 2 (1): 31–45. 2013. doi:10.1002/wdev.78. PMID 23799629. 
  27. Ferrier, David E. K. (2016). "Evolution of Homeobox Gene Clusters in Animals: The Giga-Cluster and Primary vs. Secondary Clustering" (in en). Frontiers in Ecology and Evolution 4. doi:10.3389/fevo.2016.00036. ISSN 2296-701X. 
  28. "Hox proteins: sculpting body parts by activating localized cell death". Current Biology 12 (22): R776-8. November 2002. doi:10.1016/S0960-9822(02)01291-5. PMID 12445403. 
  29. "Cloning of an X. laevis gene expressed during early embryogenesis coding for a peptide region homologous to Drosophila homeotic genes". Cell 37 (2): 409–14. June 1984. doi:10.1016/0092-8674(84)90371-4. PMID 6327066. 
  30. "Redesigning the body plan of Drosophila by ectopic expression of the homoeotic gene Antennapedia". Nature 325 (6107): 816–8. 1987. doi:10.1038/325816a0. PMID 3821869. Bibcode1987Natur.325..816S. 
  31. "Hoxa-13 and Hoxd-13 play a crucial role in the patterning of the limb autopod". Development 122 (10): 2997–3011. October 1996. doi:10.1242/dev.122.10.2997. PMID 8898214. 
  32. "Hox genes in digit development and evolution". Cell and Tissue Research 296 (1): 19–25. April 1999. doi:10.1007/s004410051262. PMID 10199961. 
  33. "The role of homeobox genes in vascular remodeling and angiogenesis". Circulation Research 87 (10): 865–72. November 2000. doi:10.1161/01.res.87.10.865. PMID 11073881. 
  34. "Flow-Dependent Epigenetic DNA Methylation in Endothelial Gene Expression and Atherosclerosis". Arteriosclerosis, Thrombosis, and Vascular Biology 35 (7): 1562–9. July 2015. doi:10.1161/ATVBAHA.115.305042. PMID 25953647. 
  35. "The role of epigenetics in the endothelial cell shear stress response and atherosclerosis". The International Journal of Biochemistry & Cell Biology 67: 167–76. October 2015. doi:10.1016/j.biocel.2015.05.001. PMID 25979369. 
  36. "Induction of the angiogenic phenotype by Hox D3". The Journal of Cell Biology 139 (1): 257–64. October 1997. doi:10.1083/jcb.139.1.257. PMID 9314544. 
  37. "The homeobox transcription factor Hox D3 promotes integrin alpha5beta1 expression and function during angiogenesis". The Journal of Biological Chemistry 279 (6): 4862–8. February 2004. doi:10.1074/jbc.M305190200. PMID 14610084. 
  38. "Homeobox B3 promotes capillary morphogenesis and angiogenesis". The Journal of Cell Biology 148 (2): 343–51. January 2000. doi:10.1083/jcb.148.2.343. PMID 10648567. 
  39. "Retroviral delivery of homeobox D3 gene induces cerebral angiogenesis in mice". Journal of Cerebral Blood Flow and Metabolism 24 (11): 1280–7. November 2004. doi:10.1097/01.WCB.0000141770.09022.AB. PMID 15545924. 
  40. "Sustained expression of homeobox D10 inhibits angiogenesis". The American Journal of Pathology 161 (6): 2099–109. December 2002. doi:10.1016/S0002-9440(10)64488-4. PMID 12466126. 
  41. "HOXA3 induces cell migration in endothelial and epithelial cells promoting angiogenesis and wound repair". Journal of Cell Science 118 (Pt 12): 2567–77. June 2005. doi:10.1242/jcs.02399. PMID 15914537. 
  42. "A role for Hox A5 in regulating angiogenesis and vascular patterning". Lymphatic Research and Biology 3 (4): 240–52. 2005. doi:10.1089/lrb.2005.3.240. PMID 16379594. 
  43. 43.0 43.1 "HoxA5 stabilizes adherens junctions via increased Akt1". Cell Adhesion & Migration 1 (4): 185–95. 2007. doi:10.4161/cam.1.4.5448. PMID 19262140. 
  44. "Restoring transcription factor HoxA5 expression inhibits the growth of experimental hemangiomas in the brain". Journal of Neuropathology and Experimental Neurology 68 (6): 626–32. June 2009. doi:10.1097/NEN.0b013e3181a491ce. PMID 19458547. 
  45. "Identification of transcriptional targets of HOXA5". The Journal of Biological Chemistry 280 (19): 19373–80. May 2005. doi:10.1074/jbc.M413528200. PMID 15757903. 
  46. "The LIM domain: from the cytoskeleton to the nucleus". Nature Reviews Molecular Cell Biology 5 (11): 920–31. November 2004. doi:10.1038/nrm1499. PMID 15520811. 
  47. "Pax in development" (in en). Cell 69 (5): 719–22. May 1992. doi:10.1016/0092-8674(92)90281-G. PMID 1591773. https://www.cell.com/cell/abstract/0092-8674(92)90281-G. Retrieved 2019-12-11. 
  48. "Pax-6, a murine paired box gene, is expressed in the developing CNS". Development 113 (4): 1435–49. December 1991. doi:10.1242/dev.113.4.1435. PMID 1687460. 
  49. "Analysis of TALE superclass homeobox genes (MEIS, PBC, KNOX, Iroquois, TGIF) reveals a novel domain conserved between plants and animals". Nucleic Acids Research 25 (21): 4173–80. November 1997. doi:10.1093/nar/25.21.4173. PMID 9336443. 
  50. "Homeodomain proteins belong to the ancestral molecular toolkit of eukaryotes". Evolution & Development 9 (3): 212–9. 2007. doi:10.1111/j.1525-142X.2007.00153.x. PMID 17501745. 
  51. 51.0 51.1 51.2 51.3 51.4 "Classification and nomenclature of all human homeobox genes". BMC Biology 5 (1): 47. October 2007. doi:10.1186/1741-7007-5-47. PMID 17963489. 
  52. Coulier, François; Popovici, Cornel; Villet, Régis; Birnbaum, Daniel (15 December 2000). "MetaHox gene clusters". Journal of Experimental Zoology 288 (4): 345–351. doi:10.1002/1097-010X(20001215)288:4<345::AID-JEZ7>3.0.CO;2-Y. PMID 11144283. 
  53. "Dlx homeobox gene control of mammalian limb and craniofacial development". American Journal of Medical Genetics. Part A 140 (13): 1366–74. July 2006. doi:10.1002/ajmg.a.31252. PMID 16688724. 

Further reading

External links

This article incorporates text from the public domain Pfam and InterPro: IPR001356